KEGG   Bacillus cereus AH820: BCAH820_5422Help
Entry
BCAH820_5422      CDS       T00814                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00240  Pyrimidine metabolism
bcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BCAH820_5422 (tdk)
Enzymes [BR:bcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BCAH820_5422 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 UvrD-helicase zf-C4_ClpX
Motif
Other DBs
NCBI-ProteinID: ACK88619
UniProt: B7JHF2
Structure
PDB: 

Position
complement(5117585..5118169)
Genome map
AA seq 194 aa AA seqDB search
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFEHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTKQR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaataaatcagaacggttggattgaagtgatttgcggtagtatgttttctggt
aaatcagaagagcttatccgccgtgtgcgtcgtacgcaatttgcgaaacaacatgcaatt
gtatttaaaccatgtattgataatcgctatagtgaagaagacgttgtatcacataacgga
ttaaaggtaaaagcagttcctgtttcagcttcaaaagatatatttgaacatatcactgaa
gaaatggatgtaattgcaatcgatgaggtgcaattctttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggtttagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaacaaaa
ctacaagcagtatgttctgcatgtggatctccggcaagtcgtacacaacgattgattgat
ggagaaccagcagcatttgatgacccgattattttagttggtgcttcagagtcgtatgaa
ccacgctgtcgtcattgtcatgcagttcctacaaaacaaagataa

DBGET integrated database retrieval system