KEGG   Bacillus cereus AH820: BCAH820_5437Help
Entry
BCAH820_5437      CDS       T00814                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00071  Fatty acid degradation
bcu00072  Synthesis and degradation of ketone bodies
bcu00280  Valine, leucine and isoleucine degradation
bcu00310  Lysine degradation
bcu00362  Benzoate degradation
bcu00380  Tryptophan metabolism
bcu00620  Pyruvate metabolism
bcu00630  Glyoxylate and dicarboxylate metabolism
bcu00640  Propanoate metabolism
bcu00650  Butanoate metabolism
bcu00900  Terpenoid backbone biosynthesis
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01120  Microbial metabolism in diverse environments
bcu01130  Biosynthesis of antibiotics
bcu01200  Carbon metabolism
bcu01212  Fatty acid metabolism
bcu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAH820_5437
   00630 Glyoxylate and dicarboxylate metabolism
    BCAH820_5437
   00640 Propanoate metabolism
    BCAH820_5437
   00650 Butanoate metabolism
    BCAH820_5437
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCAH820_5437
   00072 Synthesis and degradation of ketone bodies
    BCAH820_5437
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAH820_5437
   00310 Lysine degradation
    BCAH820_5437
   00380 Tryptophan metabolism
    BCAH820_5437
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCAH820_5437
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAH820_5437
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCAH820_5437
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcu04147]
    BCAH820_5437
Enzymes [BR:bcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCAH820_5437
Exosome [BR:bcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCAH820_5437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACK92451
UniProt: B7JHG7
Position
complement(5132003..5133286)
Genome map
AA seq 427 aa AA seqDB search
MNTTLERGAIIAPLLSVTMPSKRSVLKKEMGERNMSKTVILSAARTPVGKFGGSLKDVKA
TELGGIAIKGALERANVSASDVEEVIFGTVIQGGQGQIPSRQAARAAGIPWEVQTETVNK
VCASGLRAVTLADQIIRTGDQSLIVAGGMESMSNSPYILRGARWGYRMGNNEVIDLNVAD
GLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAYRSHQRAVSANKEGRFEEEIVPVTIPQ
RKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKTATVTAGNAPGLNDGGAALVLMSEDRAK
QEGRKPLATILAHTAIAVESKDFPRTPGYAINALLEKTGKKIEDIDLFEINEAFAAVAIA
STEIAGIDPEKLNVNGGAVAMGHPIGASGARIIVTLIHALKQRGGGIGIASICSGGGQGD
AVMIEVH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaactttagagagaggtgcaatcattgcacctcttctcagcgtaacaatgccg
agcaagcgctcggtgctaaaaaaagaaatgggggaaagaaacatgagtaaaacagttatt
ttaagtgctgcaagaacaccggtggggaaatttggaggatctttaaaagatgtaaaagca
acagaacttggaggaatcgcaattaaaggagcgcttgaaagagcgaatgtttcagctagt
gatgttgaggaagttatattcggaacggttattcaaggtggacagggacaaattccatca
cgccaagctgcaagggctgctggaatcccttgggaagtgcagacggaaactgtcaataaa
gtttgtgcatcagggcttcgtgcggtgactttagcggatcaaattattcgtactggcgat
caatcactaattgtagctggtggtatggagtcgatgagtaacagtccttacattttacga
ggagcaagatggggatacagaatgggtaacaacgaagtcattgatttaaacgttgctgac
ggtttaacatgcgcattttcaggtatacacatgggtgtttatggcggagaagttgcgaag
gaagatgggatttcccgcgaagcgcaagatgaatgggcatatcgtagccatcagcgtgca
gtttcagcgaataaagaaggacgttttgaagaggaaatcgtgccagtaacgattccacaa
agaaaaggcgatcctattgtcgttgcaaaggatgaggcgccgcgtgaagatacaacaatt
gaaaaactagcaaaattaaaacctgtatttgataagacagcgacggtgacagctggtaat
gcaccagggctaaacgatggtggcgctgcacttgtattaatgagcgaagacagagcgaag
caagaaggaagaaagccgttagcgacaattttggcacatacagcaattgcagtggagtct
aaagatttcccgaggacgccaggttatgcaattaacgcattgcttgaaaaaacaggcaag
aaaattgaagacatcgatttatttgagattaatgaagcatttgcagcggtagcaattgca
agtacagaaatcgcaggaattgacccagaaaaattgaatgtaaatggcggcgcagtggcg
atgggacacccgattggagcaagcggagcgcgcattatcgttacattaatccatgcactt
aagcaacgcggcggtggaattggaattgcttcgatttgtagtggtggcggtcaaggcgat
gcagtgatgattgaagttcactaa

DBGET integrated database retrieval system