KEGG   Beutenbergia cavernae: Bcav_0004
Entry
Bcav_0004         CDS       T00893                                 

Definition
(GenBank) DNA replication and repair protein RecF
  KO
K03629  DNA replication and repair protein RecF
Organism
bcv  Beutenbergia cavernae
Pathway
bcv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Bcav_0004
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcv03400]
    Bcav_0004
DNA repair and recombination proteins [BR:bcv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Bcav_0004
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_15 AAA_21 SbcCD_C ABC_tran AAA_29
Other DBs
NCBI-ProteinID: ACQ78270
UniProt: C5BUP6
Position
4429..5622
AA seq 397 aa
MYVSDLALTDFRSYADLVIGLEPGITAFVGPNGQGKTNLVEAIGYLGTFSSHRVSGDAAL
VRWGAERAVVRAKVVRRARPTLVELEIVAGRANRARVDRSPVSRVREAAGIARSVIFAPE
DLALVKGDPDGRRRFLDDLLVQLSPRLAGVRSEYERVLRQRTALLKSAGPARRRSGDGEP
AALRTLDVWDGHLARAGAELVAARVRLVQDLRPHVGATYEQVSAAQSEARISYRASVEEA
RPDDAPTEVVESVETELTRADLVEARLLEAMARLRTREIERGVSLVGPHRDDLVLTLADM
PAKGYASHGESWSYALALRLASYALLRDDGEAGGGGEPVLVLDDVFAELDARRRTRLASI
VASAEQVLVTAAVAEDVPEELEGARMDVMGGEVLRVR
NT seq 1194 nt   +upstreamnt  +downstreamnt
gtgtacgtctccgacctcgccctcacggacttccgctcctacgccgacctcgtcatcggc
ctggagccgggcatcacggcgttcgtcggaccgaacggccagggcaagacgaacctcgtc
gaggccatcgggtacctgggcacgttctcgagccaccgcgtctccggcgacgccgccctg
gtgcggtggggcgcggagcgcgccgtggtccgggcgaaggtggtgaggcgtgcccgcccg
acgttggtcgagctcgagatcgtcgccgggcgcgccaaccgcgcccgggtggaccggtcg
ccggtctcgcgagtgcgggaggccgcagggatcgcccgctcggtgatcttcgcccccgag
gacctcgccctggtcaagggagatccggacggccgccgccggttcctcgacgacctgctc
gtgcagctcagcccacggctggccggggtgcggtcggagtacgagcgggtgctgcgccag
cgcaccgcgctgctgaagtcggcgggtccggcgcggcgcaggtccggcgacggtgagccg
gcggcgctgcgcacgctcgacgtgtgggacggtcacctggctcgggccggcgccgagctc
gtcgcggcccgggtgcgcctcgtccaggacctgcggccccatgtcggcgccacgtacgag
caggtgagcgcggcccagagcgaggcccggatctcctatcgcgcgagcgtcgaggaggcg
cggcccgacgacgcccccacggaggtcgtggagtccgtcgagaccgagctcacccgcgcg
gatctcgtcgaggcgcgcctgctcgaggcgatggcgcgcctgcggacgcgggagatcgaa
cgcggcgtcagcctcgtgggaccgcatcgcgacgacctcgtgctcacgctcgccgacatg
cccgcgaagggatacgcgtcgcacggcgagtcctggtcgtatgcgctggccttgcgcctc
gcctcgtacgcgctgctgcgcgacgacggcgaggcgggcgggggcggtgaaccggtcctc
gtcctcgacgacgtgttcgcggagctggacgcccgacgtcgcacccgcctcgcgtcgatc
gtcgcgtccgccgagcaggttctggtcacggccgcggtcgcggaggacgtgccggaggag
ctcgagggcgcgaggatggacgtcatgggcggggaggtcctgcgtgtccggtga

DBGET integrated database retrieval system