KEGG   Beutenbergia cavernae: Bcav_0333Help
Entry
Bcav_0333         CDS       T00893                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate)O-methyltrans ferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bcv  Beutenbergia cavernae
Brite
Enzymes [BR:bcv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bcav_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_11 Ubie_methyltran Methyltr_RsmB-F CMAS Methyltransf_32 Methyltransf_12 MTS Methyltransf_24 GCD14 FtsJ Methyltransf_3 RrnaAD Fibrillarin PrmA Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: ACQ78597
UniProt: C5BWD9
Position
complement(357598..358257)
Genome map
AA seq 219 aa AA seqDB search
MAAAADRTAERERRVDDAFAAVRRAPFLPRQLRHRAGDDAPLPIGHGATCSQPRTVRDML
LLLDPRPGHRVLDVGSGSGWTTALLAHLVAPDGAVVGVDLEEELVATSRAALAHAGLLDD
ETSAHEPATRTTPDPASGVAVVVHVAPPHTLGWPAAAPYDRILVSAQAAREVPDALLDQL
APTGVMVIPVRGELVVVDQDEGGRRLSAHGAYRFVPLRQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagccgccgaccggacggccgaacgggaacggcgcgtggacgacgcgttcgcc
gccgtccgccgcgcgccgttcctcccgcgtcagctgcgccaccgcgccggcgacgacgcc
ccgctcccgatcggccacggcgccacgtgcagccagccgcgcaccgtccgcgacatgctc
ctgctgctcgacccgcggcccggccaccgcgtgctcgacgtcgggtccgggtccgggtgg
accaccgccctgctggcgcatctcgtggcgccggacggcgccgtcgtcggcgtcgacctc
gaggaggagctcgtcgcgacgtcccgcgccgccctcgcgcacgcgggtcttctcgacgac
gagacgtcagcgcacgagccggccacgcgaacgacgccggacccggcgtccggcgtcgcc
gtcgtcgtccacgtcgccccaccccacacgctcggctggccggcggccgccccgtacgac
cggatcctcgtctcggcccaggcggcgcgcgaggtgcccgacgcgctcctcgatcagctc
gcccccaccggtgtgatggtgatcccggtgcggggcgagctggtcgtcgtcgatcaggac
gagggcggccgccgtctcagtgcgcacggtgcgtaccggttcgtgcccctccgtcagtga

DBGET integrated database retrieval system