KEGG   Beutenbergia cavernae: Bcav_0703Help
Entry
Bcav_0703         CDS       T00893                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00790  Folate biosynthesis
bcv01100  Metabolic pathways
Module
bcv_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcav_0703
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bcav_0703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACQ78964
UniProt: C5BYK6
Position
780221..780823
Genome map
AA seq 200 aa AA seqDB search
MASPAGDGRAVRPYDAAGVERAVRDLLIAIGEDPDRDGLRETPERLARSYEEMFAGLHTD
PREAVQTFFDLEHNELVIVSDIAVYSVCEHHLLPFHGVAHVGYIPAPSGHVTGLSKLARL
VEAYARRPQVQERLTTQIADALVHALEPRGVVVVLECEHMCMSMRGVRKPGARTVTSAVR
GALREPATRAEAMSLIRGAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccggccggtgacggtcgcgccgtccgcccgtacgacgccgcaggtgtcgag
cgggcggtacgcgacctgctgatcgccatcggggaggacccggaccgcgacgggctccgc
gagacccccgagcgcctcgcccgctcctacgaggagatgttcgccgggctgcacacggat
ccccgtgaggcggttcagacgttcttcgacctcgagcacaacgagctcgtgatcgtcagc
gacatcgccgtgtactccgtgtgcgagcaccacctcctgccgttccacggcgtcgcacac
gtcgggtacatcccggccccctcgggccacgtgaccggactgagcaagctggccaggctc
gtcgaggcgtacgcccgccgtccgcaggtgcaggagcggctgaccacgcagatcgccgac
gcgctggtccacgcgctggagccgcgcggcgtcgtcgtcgtgctcgagtgcgagcacatg
tgcatgtcgatgcgcggcgtccgcaagccgggcgcgaggaccgtgacctcggccgtgcgc
ggcgccctgcgcgagccggcgacgcgcgccgaggccatgagcctgatccggggtgcccgc
tag

DBGET integrated database retrieval system