KEGG   Beutenbergia cavernae: Bcav_0970Help
Entry
Bcav_0970         CDS       T00893                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00900  Terpenoid backbone biosynthesis
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01130  Biosynthesis of antibiotics
Module
bcv_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcav_0970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bcv01006]
    Bcav_0970
Enzymes [BR:bcv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Bcav_0970
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Bcav_0970
    2.5.1.29  geranylgeranyl diphosphate synthase
     Bcav_0970
Prenyltransferases [BR:bcv01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Bcav_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ACQ79231
UniProt: C5C045
Position
1101799..1102899
Genome map
AA seq 366 aa AA seqDB search
MTAAAPSLTGSVDLAAVEAHLDGALAERAALTSDGGAAVGSWWRAVREACRGGKRVRPAL
VLAAFHGLRDDAGPGHEEGDPDGGAAVQVAAAFELLHAAFLLHDDVIDGDLVRRGRPNLI
AELAEAAHTDGVGSSPAHEWGTAAAVLAGDVLIHAALHAVATADVPAEPRRELLELVDRC
LVRTVAGEVADVAYAARVEVPRLPDVLRMTSWKTAAYSCEAPLVAGAILAGAAPGARAAL
ADVGRAVGAAYQLRDDVLGTFGDELVTGKSTSSDLRGGKVTALVAYARHTDHAAELDALL
ALPAPGAAEIEAMRTVLVRSGALDLVEQLIDDLLRSALEALAGAELPPELREYLGSVART
AAAPQR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcggcggcgccctcgttgaccgggtcggtggatctcgcggcggtcgaggctcac
ctggacggtgccctcgccgagcgggcggcgctgacgtccgacggcggcgcagcggtcggg
agctggtggcgtgccgtgcgcgaggcctgtcgcggcgggaagcgcgtgcgccctgcgctg
gtgctcgcggcgttccacgggctgcgcgacgacgccggccccggtcacgaggagggcgat
cccgacggcggcgcggcggtgcaggtggccgccgcgttcgagctcctgcacgcggcgttc
ctcctgcacgacgacgtcatcgacggtgatctcgtccgccggggccgaccgaatctcatc
gccgagctcgccgaggccgcgcacacggacggcgtcgggtcgtctcccgcgcacgagtgg
gggacggcggcggccgtgctcgccggcgacgtcctcatccacgccgcgctccatgccgtc
gcgacggccgacgtcccggccgagccgcgtcgtgagctgctcgagctcgtcgacaggtgc
ctcgtgcggacggtggccggcgaggtggccgacgtcgcctacgccgcgcgcgtcgaggtt
ccccggctgcccgacgtcctgcggatgacgagctggaagacggccgcctactcgtgcgag
gcgccgctcgtggcgggggcgatcctcgccggggcggccccgggcgcgcgggcggcgctc
gccgacgtcggtcgagccgtcggcgccgcctaccagctgcgcgacgacgtgctgggcacg
ttcggggacgagctggtgacgggcaagagcacctcgagcgaccttcgcggcggcaaggtc
accgccctcgtcgcctacgcgcgccacaccgaccacgcggccgagctggacgccctgctg
gcccttccggcaccgggcgccgccgagatcgaggcgatgcgcacggtcctcgtgcgcagc
ggggcgctggacctcgtggaacagctcatcgacgacctgctgcggtccgcgctggaggcg
ctcgccggggcggagctgccccccgagctgcgggagtacctcggctccgtcgcgcggacg
gccgcggcgccgcagcgctag

DBGET integrated database retrieval system