KEGG   Beutenbergia cavernae: Bcav_1187Help
Entry
Bcav_1187         CDS       T00893                                 

Definition
(GenBank) 2-hydroxyglutarate dehydrogenase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00310  Lysine degradation
bcv01100  Metabolic pathways
bcv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Bcav_1187
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     Bcav_1187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox Pyr_redox_2 FAD_binding_2 FAD_binding_3 Amino_oxidase HI0933_like TrkA_N UDPG_MGDP_dh_N Thi4 NAD_binding_7 AlaDh_PNT_C FAD_oxidored ApbA Pyr_redox_3 3HCDH_N Glyco_transf_4 GIDA
Motif
Other DBs
NCBI-ProteinID: ACQ79447
UniProt: C5C143
Position
1337638..1338810
Genome map
AA seq 390 aa AA seqDB search
MHVVVVGSGIVGLATARELSRRGHRVSVLEKEDRLAAHQTGRNSGVIHSGLYYAPGSAKA
RMSVAGVASMTAFAREHGIRHEICGKLVVATERAEVPRLHALAERAEANGVPAHLVSADE
ARTYEPEVAAVEALRVSSTGIIDYVAVCQALAAELTASGGEVLLSTAFVAARSTDRGVVV
RTSDGVIRADRLVNCAGLHSDRVALASGVEPEARIVPFRGEYFQLAAGREHLVRGLIYPV
PDPSLPFLGVHLTRMVDGSVHAGPNAVLAFRREGYRWRDVDLRELGWTLAWPGTWRLGAK
QVGTGWGELVRSASKGVFARSLARLVPAIRADDIVPAEAGVRAQALRRDGRMVDDFLVQR
GEHQVHVLNAPSPAATCSLEIGRHVADLLV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgtcgtcgtggtcgggagcgggatcgtcggcctcgccaccgcccgggagctgtcc
cggcgtgggcaccgggtgagcgtcctggagaaggaggaccggctcgccgcccaccagacc
ggccgcaactccggcgtcatccactccgggctctactacgcgcccggcagcgccaaggcg
cggatgagcgtcgcgggcgtggcgtcgatgacggcgttcgcgcgcgagcacggcatccgg
cacgagatctgcggcaagctcgtcgtggccaccgagcgggccgaggtgccgcggctgcac
gcgctcgcggagcgggccgaggccaacggcgtccccgcccacctggtctcggccgacgag
gcgcgcacctacgagcccgaggtcgccgccgtcgaggcgctgcgggtctcgtccaccggc
atcatcgactacgtggccgtgtgccaggctctcgcggccgagctcacggccagcggcggg
gaggtgctgctctcgacggcgttcgtggccgcccgctccaccgaccggggcgtcgtcgtc
cggacgtcggacggcgtcatccgggctgatcgcctcgtgaactgcgccgggctgcactcc
gaccgcgtcgccctcgcgagcggggtcgagcccgaggcgaggatcgtgccgttccgcggc
gagtacttccagctcgccgccggtcgcgagcacctggtgcgcggcctgatctacccggtg
ccggacccctcgctgccgttcctcggcgtccacctcacgcggatggtggacggctcggtg
cacgccggaccgaacgccgtcctcgcgttccggcgcgagggctaccggtggcgggacgtc
gacctgcgcgagctcggctggacgctcgcgtggccgggcacgtggcgcctcggtgcgaag
caggtcggcaccggatggggcgagctcgtgcgatcggcgtcgaagggagtgttcgcacgc
agcctcgcgcggctcgtcccggcgatccgggcggacgacatcgtgcccgccgaggcaggc
gtccgcgcgcaggcgctgcggcgggacggacgcatggtggacgacttcctggtgcagcgc
ggcgagcaccaggtccacgtgctcaacgccccctccccggcggccacctgctccctcgag
atcggccgccacgtcgccgacctcctggtctag

DBGET integrated database retrieval system