KEGG   Beutenbergia cavernae: Bcav_3017Help
Entry
Bcav_3017         CDS       T00893                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00020  Citrate cycle (TCA cycle)
bcv00640  Propanoate metabolism
bcv00660  C5-Branched dibasic acid metabolism
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01120  Microbial metabolism in diverse environments
bcv01130  Biosynthesis of antibiotics
bcv01200  Carbon metabolism
Module
bcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcav_3017
   00640 Propanoate metabolism
    Bcav_3017
   00660 C5-Branched dibasic acid metabolism
    Bcav_3017
Enzymes [BR:bcv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bcav_3017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ACQ81262
UniProt: C5BZT2
Position
complement(3365990..3367177)
Genome map
AA seq 395 aa AA seqDB search
MDLFEYQARDVFEKHGVPVLGGIVATTVDEARAAAETLTSGAGSVVVVKAQVKTGGRGKA
GGVKLARSPEEAAEAAEQILGMDIKGHTVHRVMIAEGASIAEEYYFSVLLDRANRSYLAM
ASVEGGVEIEQLAVERPEALARVAVDPLVGIDAAKAAEIVAAAGFADDVAGAVADVIQKL
WTVYDAEDATLVEVNPLVRTTDGRVIALDGKVTLDDNAEFRHPEHAELEDAASADPLEAK
AKAHDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGERHGGVKPANFLDIGGGASAAVMA
AGLDVILGDPQVKSVFVNVFGGITACDEVARGIVQALEILGDKENKPLVVRLDGNAVEEG
RAILAEANHPLVTLAETMDGGADAAAAAAHSAVTA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcacgggacgtgttcgagaagcacggtgtccccgtgctc
ggcggcatcgtcgccacgacggtcgacgaggcgcgggcggcggccgagacgctgacgagc
ggcgccggttctgtcgtggtcgtcaaggcccaggtgaagaccgggggccgtggcaaggcg
ggtggcgtcaagctggcgcgttcgcccgaggaggccgccgaggccgccgagcagatcctc
gggatggacatcaaggggcacacggtgcaccgcgtgatgatcgccgagggtgcgagcatc
gccgaggagtactacttctccgtgctgctcgaccgcgcgaaccgcagctatctcgccatg
gcgagcgtcgagggcggcgtggagatcgagcagctcgccgtcgagcgtccggaggcgctg
gcgcgcgtcgccgtcgacccgctcgtcggcatcgacgccgccaaggcggcggagatcgtg
gccgcggcgggcttcgccgacgacgtcgcgggcgccgtcgccgacgtgatccagaagctg
tggaccgtctacgacgccgaggacgcgacgctcgtcgaggtcaacccgctcgtgcggacg
accgacggccgggtcatcgccctcgacggcaaggtgacgctcgacgacaacgccgagttc
cggcacccggagcacgcggagctcgaggacgccgcctccgcggacccgctcgaggccaag
gcgaaggcgcacgacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaac
ggcgcgggcctcgtcatgagcacgctcgacgtcgtcgcgtacgcgggggagcggcacggc
ggcgtcaagcccgccaacttcctggacatcggcggcggcgcctcggcggccgtgatggcc
gccggtctcgacgtcatcctcggcgacccgcaggtcaagagcgtgttcgtcaacgtgttc
ggcgggatcaccgcgtgcgacgaggtcgcccgtggcatcgtgcaggcgctggagatcctc
ggcgacaaggagaacaagcccctcgtcgtgcggctggacggcaacgccgtcgaggagggc
cgggcgatcctcgccgaggcgaaccacccgctggtgacgctcgccgagaccatggacggc
ggggccgacgctgccgccgccgcggcccactccgccgtcaccgcctga

DBGET integrated database retrieval system