KEGG   Beutenbergia cavernae: Bcav_3637
Entry
Bcav_3637         CDS       T00893                                 

Definition
(GenBank) anti-sigma-factor antagonist
  KO
K04749  anti-sigma B factor antagonist
Organism
bcv  Beutenbergia cavernae
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bcv03021]
    Bcav_3637
Transcription machinery [BR:bcv03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Bcav_3637
SSDB
Motif
Pfam: STAS_2 STAS
Other DBs
NCBI-ProteinID: ACQ81879
UniProt: C5C335
Position
4049916..4050263
AA seq 115 aa
MIEISTSATSTTVTIEGDLDLSTRPQFHAATAKLGAVRRPLLVIDASRITFLDSTGAAFL
ISLADATRKRGGAAVLRGADERVLFVLETCGALDFFRLDPEPGLQEGDGGTRLRG
NT seq 348 nt   +upstreamnt  +downstreamnt
atgatcgagatctccacgtccgcgacgtcgacaactgtgacgatcgaaggcgatctcgac
ctctccacgcgcccacagttccatgcggcgacggcgaagctcggcgccgtccgccgtccg
ctgctcgtcatcgacgcgagccggatcacgttcctcgactccaccggcgccgcgttcctc
atctcgctcgctgacgccacgcgcaagcgcggaggcgcagcggtcctgcgcggggccgac
gaacgggtcctgttcgtgctcgagacctgcggcgcgctggacttcttccgcctcgacccc
gaaccgggcctgcaggagggcgacggcgggacgcggcttcgcggctga

DBGET integrated database retrieval system