KEGG   Beutenbergia cavernae: Bcav_4014Help
Entry
Bcav_4014         CDS       T00893                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00860  Porphyrin and chlorophyll metabolism
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01120  Microbial metabolism in diverse environments
Module
bcv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcav_4014
Enzymes [BR:bcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Bcav_4014
Exosome [BR:bcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcav_4014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMS28_porin
Motif
Other DBs
NCBI-ProteinID: ACQ82255
UniProt: C5C5B5
Position
4439252..4440262
Genome map
AA seq 336 aa AA seqDB search
MTVLPPGSPRPRRLRATPALRRLTAEHRLDARDLVLPLFLREGASEAVPIASMPGVVQHS
RDSLRAEVVRAAEAGIGGVMLFGVPTTRDAEGSGADDPDGVLNTGIRDAIAEVGDAVVVM
ADLCLDEFTDHGHCGVLDGAGRVDNDATLERYAAMALAQADGGAHVLGLSGMMDGQVGHV
RAALDDAGRADTALLAYSAKYASAFYGPFRDAVESRLVGDRRAYQLDPANRREGLRETLL
DLAEGADAVMVKPALAYLDVLADVASASDVPVWAYQVSGEYAMVEAAAANGWIDRERAVR
ETLLSIVRAGADAVLTYWALDVAGWLRADGGAGGAR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcctgcctcccggcagccctcgcccgcggcgcctgcgcgcgacgccggccctg
cgccgcctcacggcggagcaccgcctcgacgcccgcgacctcgtgctcccgctcttcctc
cgagagggcgcgagcgaggccgtcccgatcgcgtcgatgcccggcgtcgtccagcactcc
cgcgactcgctgcgcgccgaggtggtacgcgccgcggaggccggcatcggtggcgtcatg
ctgttcggcgtcccgacgacgcgcgacgccgagggctccggcgccgacgaccccgacggc
gtgctgaacacgggcatccgcgacgcgatcgcggaggtgggggacgccgtcgtcgtcatg
gcggacctgtgcctcgacgagttcaccgaccacgggcactgcggcgtgctcgacggcgcc
gggcgggtcgacaacgacgccaccctcgagcggtatgccgcgatggcgctcgcgcaggca
gacggcggcgcccacgtgctggggctcagcgggatgatggacggccaggtgggccacgtg
cgggcggcgctcgacgacgccggccgcgccgacaccgcgctcctcgcctactccgcgaag
tacgcgagcgcgttctacgggccgttccgggacgccgtcgagtcgaggctcgtcggggac
cggcgcgcgtaccagctcgacccggcgaaccgccgcgaaggcctgcgcgagaccctgctc
gacctggccgagggcgcggacgccgtcatggtcaagcccgcgctcgcctacctcgacgtg
ctcgccgacgtggcctccgccagcgacgtgcccgtgtgggcgtaccaggtgagcggcgag
tacgcgatggtcgaggcggccgccgcgaacggctggatcgaccgggagcgtgccgtgcgc
gagacgctgctgtccatcgtgcgggccggcgcggacgcggtcctcacgtactgggcgctc
gacgtcgccggctggctgcgcgcggacggcggcgcgggaggtgcccggtga

DBGET integrated database retrieval system