KEGG   Borrelia crocidurae: Q7M_208Help
Entry
Q7M_208           CDS       T02051                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcw  Borrelia crocidurae
Pathway
bcw00052  Galactose metabolism
bcw00500  Starch and sucrose metabolism
bcw00520  Amino sugar and nucleotide sugar metabolism
bcw01100  Metabolic pathways
bcw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q7M_208
   00052 Galactose metabolism
    Q7M_208
   00500 Starch and sucrose metabolism
    Q7M_208
   00520 Amino sugar and nucleotide sugar metabolism
    Q7M_208
Enzymes [BR:bcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Q7M_208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFI30987
UniProt: I0FBY1
Position
211136..211966
Genome map
AA seq 276 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPSIDYIIEEFINSGIKEILIITSRRKKVL
DNYFDREVELEHTFIKECQKDFLEQIKLKDINICFIRQNTMMGTGHALLHAKPWIGNESV
IVAYPDDLHIGSPPLTAQLIELYKKTGKNILSVIENPKNINRYGVIELNQDNIHVKNIVE
KPAIGHEPSNKASIGRFLYTNEFFKFLEEGFKFHQKGEYHHIYALKKLMIENKVLYKKIE
GERLDIGDIEGYLETIIKIAKQDDKLLQIINNSLRN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtattatattagcagcaggatatggcacaagatttttacccataacaaaaact
attccaaaagaaatgttaccaattttaaataaaccatcaattgattatattattgaagaa
tttattaattctggaattaaagaaatactcataataacttcaagaagaaaaaaagttttg
gataattactttgacagagaagttgaacttgaacatacattcatcaaagaatgccaaaaa
gattttttagaacaaattaaacttaaagacattaacatttgttttataagacaaaataca
atgatgggcacagggcatgcattacttcatgcaaagccttggataggcaatgaaagcgta
atagttgcataccccgatgatctacatattggatcaccacccttaacagcacaattaata
gaactatataaaaaaactggtaaaaatatattatccgttatcgaaaatcccaaaaatatc
aatagatacggagtaatagaattaaatcaagataatattcatgtaaaaaacatagtagaa
aaaccagcaattggtcacgaaccaagcaataaagcatctataggaagattcttatatacc
aatgaattttttaaatttttagaagaaggttttaaatttcaccaaaaaggagaatatcac
catatttatgcattaaagaaactaatgattgaaaacaaagtattatacaaaaaaattgaa
ggagaaagacttgatataggtgatattgaaggttatttagaaacaataatcaaaattgca
aaacaagatgataaattactccaaatcatcaacaattcattaaggaattaa

DBGET integrated database retrieval system