KEGG   Borrelia crocidurae: Q7M_639Help
Entry
Q7M_639           CDS       T02051                                 

Definition
(GenBank) Exodeoxyribonuclease V, alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcw  Borrelia crocidurae
Pathway
bcw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Q7M_639
Enzymes [BR:bcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Q7M_639
DNA repair and recombination proteins [BR:bcw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Q7M_639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 AAA_11 UvrD_C_2 Helicase_RecD PhoH DUF2075 T2SSE AAA_22 RsgA_GTPase AAA_5 AAA AAA_16 AAA_28 RNA_helicase DEAD TsaE Zeta_toxin PRR18 CobA_CobO_BtuR
Motif
Other DBs
NCBI-ProteinID: AFI31418
UniProt: I0FD62
Position
complement(667227..669053)
Genome map
AA seq 608 aa AA seqDB search
MRNYLVLREFLQEEQKNYLNPELKIYEIIEILNINVEQYYKSHLLTKKIQNDKYEELTIF
LIFIFNYFSKGHLRANIDLLIQDIQNTIDCALLELEEENQHYQKSTHILQELTKFSKETQ
IKEMILYLEKNNIMKNYNQNEKITTPLILENNIYIYTQKNFREEEELIKQIDKRLKNNKT
EISDDRIQNIMDHLNITNLSKEQINSIKKALKSNFFILSGGPGTGKTTTINYILKAIDIH
LDCKQNVALVAPTGKASQKLKSSIKEPFKNLETQYSTIQKLLKISFINKDDKYDENNPLE
FEIIIIDEASMIDANTFLRLLKALKANTKIIITGDKNQLPSIAGGNVYSSLTKIKEINDD
SVEILKKNFRSNDEINLLAKAIYKEDMDLIETQFNDSKNIILKNLNKINIENELLKHTKK
LYNNIPNFNLNSLNDKEIESIIHTLLSNTILCSKNLGKFGTQKINEIIKLYLKKLYGNLI
GQIILITQNDYKNDLFNGERGILFKENSKIYALFKRENEKYKKINFNLINKYELSFATTI
HKSQGSEYQHIQIIIENHPFLTKELLYTAITRARESIEIISNKEIIKNVSLKKINRDSKI
TEYINTLK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattatttagtcttaagagaattcctacaagaagagcaaaaaaactacttaaat
ccagaactcaaaatttatgaaataattgaaattttaaatataaatgtagaacaatattac
aaatcacatttacttacaaaaaaaatacaaaatgacaaatatgaagaacttaccattttt
ttaatattcatatttaattacttctctaaaggacacttaagagcaaatattgatctacta
atacaagatattcaaaacacaatcgactgtgctttactcgaattagaagaagaaaatcaa
cactatcaaaaatcaacacacatattacaagaacttacaaaattttcaaaagaaactcaa
ataaaagaaatgatattatatttagaaaaaaataatataatgaaaaattacaatcaaaat
gaaaaaataacaactcctttaatattagaaaataatatttacatttacacccaaaaaaat
tttagagaagaagaagaattaataaaacaaatagacaaaagacttaagaacaataaaaca
gaaataagtgatgatagaatacagaacatcatggatcacttaaatattacaaatttaagt
aaagaacaaataaactcaattaaaaaagctttaaaaagtaatttttttatattaagtggt
ggaccaggaacaggcaaaacaacaacaattaactatattctcaaagcaattgacatacat
ttagattgtaaacaaaacgtagctcttgtagcaccaaccggaaaagcaagtcaaaaattg
aaatcaagtattaaagaaccatttaaaaaccttgaaacacaatatagcacaatacaaaaa
ctattaaaaatatcattcataaataaagacgacaaatatgatgaaaataatcctttagaa
ttcgaaataattataatagatgaagcatctatgatagatgcaaatacctttttaagatta
ttaaaagcattaaaggcaaatacaaaaattataataacaggggataaaaaccaacttcca
tcaatagctggaggaaatgtatattccagccttacaaaaataaaagaaataaatgatgat
agtgtagaaatactgaaaaaaaattttagaagcaatgatgaaataaatttattagccaaa
gcaatatataaagaagatatggacttaattgaaactcaatttaatgatagcaaaaacata
attctaaaaaacctaaataaaataaatattgaaaatgaattactaaaacatacaaaaaaa
ttatacaataacattcccaatttcaatcttaactcgttaaatgacaaagaaattgaatca
ataattcatacactgcttagtaacacaattttatgttcaaaaaatcttggaaaatttggc
acacaaaaaataaatgaaataattaaattatatttaaaaaaattatatggaaatttaatt
ggacaaataattttaattactcaaaatgattataaaaatgacctatttaatggggagaga
ggaatactttttaaagaaaattctaaaatttatgctctatttaaaagagaaaatgaaaaa
tacaaaaaaataaacttcaacttaataaataaatatgaactgagctttgcaacaacaata
cataaaagccagggctctgaataccaacacatacaaattataatagaaaatcaccctttc
ttaacaaaagaattactctacactgcaataacaagagctagagaaagtatagaaataata
tcaaacaaagagataattaaaaatgtcagtttaaagaaaatcaatagagactccaaaatt
acagaatacataaacacgttaaaataa

DBGET integrated database retrieval system