KEGG   Borrelia crocidurae: Q7M_667Help
Entry
Q7M_667           CDS       T02051                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcw  Borrelia crocidurae
Pathway
bcw00010  Glycolysis / Gluconeogenesis
bcw00260  Glycine, serine and threonine metabolism
bcw00680  Methane metabolism
bcw01100  Metabolic pathways
bcw01110  Biosynthesis of secondary metabolites
bcw01120  Microbial metabolism in diverse environments
bcw01130  Biosynthesis of antibiotics
bcw01200  Carbon metabolism
bcw01230  Biosynthesis of amino acids
Module
bcw_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bcw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7M_667
  Energy metabolism
   00680 Methane metabolism
    Q7M_667
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7M_667
Enzymes [BR:bcw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Q7M_667
Membrane trafficking [BR:bcw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Q7M_667
Exosome [BR:bcw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Q7M_667
  Exosomal proteins of melanoma cells
   Q7M_667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFI31446
UniProt: I0FD90
Position
700941..701693
Genome map
AA seq 250 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGVSEACEGGRILKKEGYSFDIAFSSMLLR
ANDTLNIILCELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLIWRRSYNVP
PMPLDESDKRHPIHDSRYKNIPKSELPSTECLKDTVARVIPYWTDKIAKAILEGKRVIVA
AHGNSLRALVKYLDNMSEEDILKLNIPTGIPLVYELDKDLKPVKHYYLGDEDKIKAAMES
VANQGKKIDR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtgaggcatggtgagagtgaatggaataaggaaaatcttttt
acaggatggactgatgttaaactttctgagaagggtgtttctgaagcttgtgagggtggt
agaatattgaaaaaggaaggttattcttttgatattgcttttagctcaatgttattaaga
gctaatgatactttaaatattattttgtgtgaattgggtcaatcgtatattgatgtagaa
aaatcttggcgacttaatgagagacattatggggcattgcaaggattaaataaggctgaa
acggctgaaaagtatggcgaagataaagttctcatttggagacgtagttataatgttcct
cctatgcctttggatgagtctgataagcgtcatcctattcatgattcaagatataaaaat
attcctaaaagtgaacttccttcaaccgagtgtttaaaagatactgttgcaagagttata
ccatattggacagataaaattgctaaggctattcttgaaggaaaaagagttattgttgct
gctcatggtaattctttaagagcccttgttaaatatcttgataatatgagtgaagaagat
attttaaagctaaatattccaacgggtattcctttagtttatgagcttgataaggattta
aaacccgttaaacattactatttgggcgatgaagataaaattaaggcagctatggaatct
gttgctaatcaaggtaaaaaaatagatagataa

DBGET integrated database retrieval system