KEGG   Bacillus cereus 03BB102: BCA_0021Help
Entry
BCA_0021          CDS       T00869                                 

Definition
(GenBank) deoxynucleoside kinase family protein
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00230  Purine metabolism
bcx00240  Pyrimidine metabolism
bcx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BCA_0021
   00240 Pyrimidine metabolism
    BCA_0021
Enzymes [BR:bcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BCA_0021
    2.7.1.76  2'-deoxyadenosine kinase
     BCA_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Cytidylate_kin2 AAA_33 TsaE Thymidylate_kin AAA_28 AAA_29 CbiA PRK RNA_helicase AAA_25 RsgA_GTPase ParA AAA_16 ABC_tran IstB_IS21 AAA MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ACO30564
UniProt: A0A158RTD6
Position
complement(22346..23014)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatataccaaatgacgcagtaatcactatcgctggaaca
gtaggtgtcggtaaatccactatgacaactgcattagctaacgctttaggatatcgcaca
tcatttgaaaaggtagattctaacccgtatttggacaagttctatgctgatttcacacgc
tggagctttcacttacaagtgtactttttagcagaacgatttaaagaacaaaaaaggatt
tttgaatacggtggtggttttgttcaagatcgctctatctatgaagacactggcattttt
gcaaaaatgcatcacgaaaagggtacaatgacggaaactgattatgaaacatacaaaggt
ttatttgacgctatggtcatgactccttacttccctcatccagatttactaatctactta
gaaggttctttcgatgatatcgttgatcgtatccaagaacgtggacgtccgatggaacag
caaacgccaattgagtattggaaagagatgcatgggcgttatgaaaactggattaataac
tttaattcatgccctgtcttacgattaaatattaatgaatacgatattttaaaagatggc
gattccattgaaccaatcattaaaaagatcggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system