KEGG   Bacillus cereus 03BB102: BCA_0128
Entry
BCA_0128          CDS       T00869                                 

Gene name
rplJ
Definition
(GenBank) 50S ribosomal protein L10
  KO
K02864  large subunit ribosomal protein L10
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bcx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BCA_0128 (rplJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bcx03011]
    BCA_0128 (rplJ)
Ribosome [BR:bcx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BCA_0128 (rplJ)
  Bacteria
    BCA_0128 (rplJ)
  Archaea
    BCA_0128 (rplJ)
SSDB
Motif
Pfam: Ribosomal_L10
Other DBs
NCBI-ProteinID: ACO27663
UniProt: C1ET28
Position
112090..112590
AA seq 166 aa
MSKVIETKQQVVTEIADKLRASKSTIVVDYRGLTVSEATELRKQLREAGVEFKVYKNSLT
RRAAESAEMAELNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHEALEIKAGVIEGKLVTL
DEVKAIATLPSREGLLSMLLSVLQAPIRNLALATKAVADQKEEQGA
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagcaaagtaatcgaaactaaacaacaagttgtaactgaaatcgcggacaaacttcgc
gctagtaaatctacaatcgttgttgactaccgtggtttaacagtttctgaagcaacagaa
ttacgtaagcaattacgtgaagctggcgttgagttcaaagtttacaaaaactctctaact
cgtcgtgctgcagaatctgctgaaatggctgagttaaatgaattcttaacaggaccaaac
gcaatcgcgttcagtaacgaggatgtagttgctcctgcgaaagtattaaacgacttcgct
aaagatcatgaagctttagaaattaaagcgggcgtaatcgaaggtaaacttgtaacactt
gatgaggttaaagccatcgctactcttccatcacgtgaaggcttactttctatgcttctt
agcgttcttcaagctccaatccgtaaccttgcacttgctactaaagcagttgcagatcaa
aaggaagagcaaggcgcttaa

DBGET integrated database retrieval system