KEGG   Bacillus cereus 03BB102: BCA_2601Help
Entry
BCA_2601          CDS       T00869                                 

Gene name
fba1
Definition
(GenBank) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00010  Glycolysis / Gluconeogenesis
bcx00030  Pentose phosphate pathway
bcx00051  Fructose and mannose metabolism
bcx00680  Methane metabolism
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01120  Microbial metabolism in diverse environments
bcx01130  Biosynthesis of antibiotics
bcx01200  Carbon metabolism
bcx01230  Biosynthesis of amino acids
Module
bcx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_2601 (fba1)
   00030 Pentose phosphate pathway
    BCA_2601 (fba1)
   00051 Fructose and mannose metabolism
    BCA_2601 (fba1)
  09102 Energy metabolism
   00680 Methane metabolism
    BCA_2601 (fba1)
Enzymes [BR:bcx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BCA_2601 (fba1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase His_biosynth FMN_dh TMP-TENI AP_endonuc_2 CutC
Motif
Other DBs
NCBI-ProteinID: ACO29938
UniProt: A0A158RRI2
Position
2421941..2422786
Genome map
AA seq 281 aa AA seqDB search
MPLVQMKDILMKAYQENYGVGAFSVANMKMVMGAIKAAEELSSPLILQIAEVRLNHSPIH
MIGPLMVAAAKQATVPVAVHFDHGMTFNKIQETLEIGFSSVMFDGSHYPLEENIQKTKEI
VELAKQYGATVEAEIGRVGGSEDGSEDIEMLLTSTTEAKRFAEETDVDALAVAIGNAHGM
YNGDPNLRLDRLQEINEVVHIPLVLHGGSGISPEDFKRCIQHGVRKINVATATFQNVITA
VNTAVLNNPYSDYFTYHQDVIEAAYENVKIHMQIFGSENRV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccattagttcaaatgaaagatattttaatgaaagcatatcaagagaattatggggtt
ggagcttttagtgtcgcgaatatgaaaatggtaatgggagctattaaagcagctgaagag
ttaagttcgccgcttattctacaaattgcggaagttcgtttgaatcattcgccaattcat
atgattggtccattgatggtagctgcagcgaaacaagcaactgttccagtagcagttcac
tttgatcacggtatgacatttaataagattcaagagacgttagaaattggttttagttcg
gttatgtttgatggctctcactatccgttagaagagaatatccaaaagacaaaagaaatt
gtagaacttgcgaaacagtatggagcgacggtagaagctgagattggtagagttggtggt
agtgaggacggatcagaagatattgaaatgttgctgacaagcactacagaagcaaaacga
tttgctgaagaaacagacgttgatgcgttagcggttgcaattggaaatgcgcatggtatg
tacaatggcgatcctaatttacgattagaccgcctacaagagattaatgaagtagtccat
atcccgctcgttttacatggcggctctggcattagtccagaggatttcaagcgatgtatt
caacatggtgttcgaaaaataaatgtagcaacagccacatttcagaatgtaattactgct
gttaacactgccgtcctaaataatccgtattcagattactttacgtaccaccaggatgtt
attgaggctgcatacgaaaatgttaaaattcatatgcaaatattcggaagtgaaaacaga
gtataa

DBGET integrated database retrieval system