KEGG   Bacillus cereus 03BB102: BCA_3204Help
Entry
BCA_3204          CDS       T00869                                 

Definition
(GenBank) alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCA_3204
Enzymes [BR:bcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BCA_3204
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BCA_3204
    1.1.1.-  
     BCA_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 Cas_csx3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACO31244
UniProt: A0A158RUU5
Position
complement(2971850..2972872)
Genome map
AA seq 340 aa AA seqDB search
MKAAVWYGERDIRIEEREVKELQPNDVKVKVAWAGICGSDLHAYLHPDSVPMNKNMVIGH
EFSGEIVEVGSHVTKFKEGDRVCIYPMMLKDPSNAETERFITIDAVGAHIDGGFAEYAIL
PQKTIFKIPDNLPLEVAAMVEPAAVSFQSIKDLNVKEGDTVVVYGAGPIGLFAVLGAKVA
GASNIIVVDLLDSRLDKATEMGATHVFNAKEVNPVEEIRKLFPDGADVTVEAAGVESTFN
QAIQSTKVRGTMMVISFHTEDIQFNGPASLIFSGVKIMGSVGYSNETYNEVIELLANGGL
PAQSIITSKINIDNLVEQGFEALMNDKSQAKILVKLSGAH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagtgtggtatggcgaaagagatattcgtattgaggaaagagaagtgaaa
gaattacaacctaatgatgtaaaagttaaagtagcatgggctggtatttgtgggtctgat
ttacatgcatatttgcatccggattcagtaccaatgaataagaatatggtaatcggacat
gaattttctggtgaaattgtagaggtcggttctcatgttacgaaatttaaagaaggtgac
agagtatgtatctatccaatgatgcttaaagatccttcaaatgctgaaacggaacgtttc
atcactatagacgcggttggtgcacatatcgacggagggtttgcagaatacgcgatactt
ccacaaaaaacgatttttaaaattccagataatttaccactagaagtagcagcaatggtt
gaacccgcagctgtatctttccaatcaattaaggatttaaatgtaaaagaaggagataca
gttgttgtttatggagcgggtccaattgggttatttgctgtattaggtgcaaaagtagct
ggtgcttctaatattattgttgtcgatttattggatagtcgactcgataaagcaactgaa
atgggtgcaacacatgtctttaatgctaaagaagtgaaccctgttgaagaaattcgtaaa
ttattcccagatggagcagatgttacagttgaagctgcaggtgttgagtcaacatttaat
caagccattcaatcaactaaagttcgtggcacaatgatggttatcagttttcacacggaa
gatatccagtttaatggtcctgcttcattaatttttagtggtgtaaaaataatggggtct
gtaggatacagtaatgaaacttacaatgaggtcattgaattacttgctaacggaggattg
ccagcgcaatcaattattacaagtaaaattaatatagataatctcgttgaacaaggcttt
gaagcactaatgaatgataagtctcaagcaaaaattctagttaaattaagtggcgcacat
taa

DBGET integrated database retrieval system