KEGG   Bacillus cereus 03BB102: BCA_3648Help
Entry
BCA_3648          CDS       T00869                                 

Gene name
dhaS
Definition
(GenBank) aldehyde dehydrogenase (NAD)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00010  Glycolysis / Gluconeogenesis
bcx00053  Ascorbate and aldarate metabolism
bcx00071  Fatty acid degradation
bcx00280  Valine, leucine and isoleucine degradation
bcx00310  Lysine degradation
bcx00330  Arginine and proline metabolism
bcx00340  Histidine metabolism
bcx00380  Tryptophan metabolism
bcx00410  beta-Alanine metabolism
bcx00561  Glycerolipid metabolism
bcx00620  Pyruvate metabolism
bcx00625  Chloroalkane and chloroalkene degradation
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01120  Microbial metabolism in diverse environments
bcx01130  Biosynthesis of antibiotics
Module
bcx_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_3648 (dhaS)
   00053 Ascorbate and aldarate metabolism
    BCA_3648 (dhaS)
   00620 Pyruvate metabolism
    BCA_3648 (dhaS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCA_3648 (dhaS)
   00561 Glycerolipid metabolism
    BCA_3648 (dhaS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCA_3648 (dhaS)
   00310 Lysine degradation
    BCA_3648 (dhaS)
   00330 Arginine and proline metabolism
    BCA_3648 (dhaS)
   00340 Histidine metabolism
    BCA_3648 (dhaS)
   00380 Tryptophan metabolism
    BCA_3648 (dhaS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCA_3648 (dhaS)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCA_3648 (dhaS)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCA_3648 (dhaS)
Enzymes [BR:bcx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BCA_3648 (dhaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACO31027
UniProt: A0A158RUT4
Position
3400969..3402453
Genome map
AA seq 494 aa AA seqDB search
MSQLAVNLHEKVEKFLQGTKKLYVNGSFVESASGKTFNTPNPATGETLAVVSEAGREDIH
KAVVAARMAFDEGPWSRMSTAERSRLMYKLADLMEEHKEELAQLETLDNGKPIRETMAAD
IPLAIEHMRYYAGWATKIVGQTIPVSGDFFNYTRHEAVGVVGQIIPWNFPLLMAMWKMGA
ALATGCTIVLKPAEQTPLSALYLAELIEEAGFPKGVINIVPGFGESAGQALVNHPLVDKI
AFTGSTPVGKQIMRQASESLKRVTLELGGKSPNIILPDADLSRAIPGALSGVMFNQGQVC
SAGSRLFVPKKMYDNVMADLVLYSKKLNQGVGLDPETTIGPLVSEEQQKRVMGYIEKGIE
EGAEVLCGGNNPFDQGYFISPTVFADVNDEMTIAKEEIFGPVISAIPFNDIDEVIERANK
SQFGLAAGVWTENVKTAHYVASKVRAGTVWVNCYNVFDAASPFGGFKQSGLGREMGSYAL
NNYTEVKSVWLNLN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaactagctgtaaatcttcatgaaaaggtagaaaagtttcttcaaggtacgaaa
aagttatatgtgaatggatcattcgttgaaagcgcttccggtaagacgtttaatacacct
aatccagcaactggcgaaacacttgccgtcgtttctgaagccggtcgcgaagatattcat
aaagctgtagttgcagctcgcatggcttttgacgaaggtccttggtctcgcatgagcact
gcggagcgaagccgtcttatgtacaagttagctgatttaatggaagaacataaagaagag
cttgcacagctcgagacgttagataacggaaagccaatccgtgaaacaatggcagcagac
ataccacttgcaattgagcacatgcgctattatgctggctgggcgacgaaaatcgttggt
caaacaatccctgtttccggtgatttctttaactatacacgccatgaagctgttggtgtc
gttggtcaaattatcccttggaacttcccgcttcttatggccatgtggaaaatgggagca
gcgcttgctacaggatgtacaatcgttttaaaacctgcagaacaaactccactatctgct
ctatacttagctgaattaattgaagaagctggattcccgaaaggcgttattaatatcgtt
cctggattcggtgaatcagctggacaagctctcgttaatcatccactcgttgataaaatt
gcatttaccggttctactccagtcggtaaacaaattatgcgacaagcatctgaatccttg
aaacgtgttactttagagcttggtggtaaatcaccgaacattattttaccagacgctgat
ttatctcgcgcaattcctggtgcactttctggtgttatgtttaaccaagggcaagtatgc
tctgctggatcacgcctatttgttccgaagaaaatgtatgataatgtcatggctgatctc
gtcctctattctaaaaaactaaatcaaggtgtcggtcttgaccctgaaacgacaattggt
cctctcgtttccgaagaacaacaaaaacgtgtaatgggctacattgaaaaagggattgaa
gaaggcgctgaagtactttgcggaggaaataatccattcgatcaaggctacttcatttct
cctacagtattcgctgacgtaaatgacgaaatgacaatcgcaaaagaagaaattttcggt
ccagttatttctgcaataccttttaacgatattgatgaagtaattgaacgagcaaataaa
tcacaattcggcttagcggctggtgtgtggacagaaaatgttaaaacagcacactatgtt
gcaagtaaagtacgtgcaggtacagtatgggttaactgttacaacgtctttgatgcagca
tctccatttggaggatttaaacaatctggtctcggccgtgaaatgggatcttacgcatta
aataactatacagaagtgaagagcgtttggcttaacttaaattaa

DBGET integrated database retrieval system