KEGG   Bacillus cereus 03BB102: BCA_4075Help
Entry
BCA_4075          CDS       T00869                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00010  Glycolysis / Gluconeogenesis
bcx00020  Citrate cycle (TCA cycle)
bcx00620  Pyruvate metabolism
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01120  Microbial metabolism in diverse environments
bcx01130  Biosynthesis of antibiotics
bcx01200  Carbon metabolism
Module
bcx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_4075 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BCA_4075 (pdhC)
   00620 Pyruvate metabolism
    BCA_4075 (pdhC)
Enzymes [BR:bcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCA_4075 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: ACO27676
UniProt: A0A158RKR6
Position
complement(3832509..3833795)
Genome map
AA seq 428 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAKEEAPKAEATPAATAEVVNE
RVIAMPSVRKYARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPA
AKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHRK
KFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTDK
GLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTPV
INHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLND
PQLLVMEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgacgaagtaaacgaagacgacgtacttcttgaagtacaa
aatgataaagcagtagtagaaattccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggtacggttgcagtagttggagatacattaattaaatttgatgctccagga
tacgaaaaccttaaatttaaaggcgacgatcatgacgaagctcctaaagctgaagaagca
aaagaagaagctcctaaagctgaagctactccagcagcaactgcagaagtagtaaatgag
cgcgtaatcgctatgccatctgttcgtaaatatgctcgtgaaaacggcgtagacattcat
aaagtagctggttctggtaagaacggtcgtatcgtaaaagctgacatcgatgcatttgca
aatggtggacaagcagtagcagcaactgaggctccagcagcagtagaagctactccagca
gcgaaagaagaagcaccaaaagcacaaccaatcccagctggtgaatatccagaaactcgt
gagaaaatgagtggtatccgtaaagcaattgcgaaagcaatggttaactctaaacataca
gctcctcacgtaacattaatggatgaagtagatgtaactgaacttgttgctcaccgtaag
aagttcaaagctgtggcagctgacaaaggtattaaattaacttaccttccatacgttgtt
aaagctttaacatctgcattacgtgaatacccaatgttaaacacttctttagatgatgct
tctcaagaagtagttcataaacattacttcaacatcggtatcgcagctgatacagacaaa
ggtctattagtaccagttgttaaagatacagatcgcaagtctatcttcacaatttctaac
gagatcaatgatcttgctggtaaagcacgtgaaggtcgtttagctcctgctgaaatgaaa
ggcgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactccagtt
atcaaccacccagaagtagcaatccttggtatcggccgtatcgctgagaaaccagttgtg
aaaaacggtgagatcgttgcagctccagtattagcattatctctaagctttgaccatcgt
ttaattgacggcgcaactgctcaaaaagcattaaaccaaattaaacgtctattgaatgac
ccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system