KEGG   Bacillus cereus 03BB102: BCA_4134Help
Entry
BCA_4134          CDS       T00869                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00071  Fatty acid degradation
bcx00072  Synthesis and degradation of ketone bodies
bcx00280  Valine, leucine and isoleucine degradation
bcx00310  Lysine degradation
bcx00362  Benzoate degradation
bcx00380  Tryptophan metabolism
bcx00620  Pyruvate metabolism
bcx00630  Glyoxylate and dicarboxylate metabolism
bcx00640  Propanoate metabolism
bcx00650  Butanoate metabolism
bcx00900  Terpenoid backbone biosynthesis
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01120  Microbial metabolism in diverse environments
bcx01130  Biosynthesis of antibiotics
bcx01200  Carbon metabolism
bcx01212  Fatty acid metabolism
bcx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCA_4134
   00630 Glyoxylate and dicarboxylate metabolism
    BCA_4134
   00640 Propanoate metabolism
    BCA_4134
   00650 Butanoate metabolism
    BCA_4134
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCA_4134
   00072 Synthesis and degradation of ketone bodies
    BCA_4134
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCA_4134
   00310 Lysine degradation
    BCA_4134
   00380 Tryptophan metabolism
    BCA_4134
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCA_4134
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCA_4134
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCA_4134
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcx04147]
    BCA_4134
Enzymes [BR:bcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCA_4134
Exosome [BR:bcx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCA_4134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACO29981
UniProt: A0A158RRX1
Position
complement(3885584..3886759)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagtggatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgttgttgcaggtggagtagaagcaatgagttca
agcccctatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagctgggttaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccgaaaattatgggtattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaacggt
agtggtgtaggacttggacatccaattggttgtacaggagctcgtattacggtaagttta
attcatgaattaaaaagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggt
ggtattggggtagcattatttatagaagcactataa

DBGET integrated database retrieval system