KEGG   Bacillus cereus 03BB102: BCA_4470Help
Entry
BCA_4470          CDS       T00869                                 

Definition
(GenBank) putative phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00360  Phenylalanine metabolism
bcx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcx00790  Folate biosynthesis
bcx01100  Metabolic pathways
bcx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BCA_4470
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCA_4470
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCA_4470
Enzymes [BR:bcx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BCA_4470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ACO30805
UniProt: A0A158RTY6
Position
4171256..4173010
Genome map
AA seq 584 aa AA seqDB search
MTKKTEIPSHLKPFVSTQHYDQYTPVNHAVWRYIMRQNHSFLKDVAHPAYVNGLQSSGIN
IEAIPKVEEMNDCLASSGWGAVTIDGLIPGVAFFDFQGHGLLPIATDIRKVENIEYTPAP
DIVHEAAGHAPILLDPTYAKYVKRFGQIGAKAFSTKEEHDAFEAVRTLTIVKESPTSTPD
EVTAAENNVIEKQNLVSGLSEAEQISRLFWWTVEYGLIGDIDNPKIYGAGLLSSVGESKH
CLTDAVEKVPFSIEACTSTTYDVTKMQPQLFVCKSFEELTEALEKFAETMAFKTGGKEGL
EKAIRSENHATAELNSGLQITGTFTETIENDAGELIYMRTSSPTALAIHNKQLANHSTAV
HSDGFGTPIGLLTENIALENCTDEQLQALGITIGNIAEFTFESGIHVKGTVIDIVKNDNK
IALISFINCTVTYKDRVLFDASWGAFDMAVGSTITSVFPGAADAAAFFPMDEEIQEIPAP
LVLNELERMYQTVRDIRNEGILHDAHIDQLVAIQEVLNKFYAKEWLLRLEILELLLEHNK
GHETSAALLQQLSTFTTDEAVTRLINNGLTLLPVKDVKNDATIN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaacagaaattccatcgcatttaaaaccattcgtatctacacagcattat
gatcaatacacaccggtaaaccacgctgtatggcgttacattatgagacaaaatcatagt
ttcttaaaagacgttgctcatccagcctatgtgaatggactacaatcatctggtattaat
atagaggcaatcccaaaggtagaagaaatgaatgactgtttggcgtcaagcggctggggc
gctgtaacgattgacggacttattcctggcgtcgcatttttcgattttcaagggcacgga
ttactaccaatcgcaacagatattcgcaaagtagaaaacatcgagtatacacctgctcca
gatattgtacacgaagcagcaggacacgcacctattttacttgatcctacatatgcaaaa
tatgtaaaacgatttgggcaaattggtgcaaaagctttttctacaaaagaagaacatgat
gcattcgaagctgttcgtacattaacgattgtaaaagaaagccctacttctactcctgat
gaagttacagctgctgaaaataatgtaattgaaaaacaaaacttagtttctggcttatca
gaagcggaacaaatttcacgtcttttctggtggacagtggaatacggattaattggagat
atagataatccaaaaatatatggtgctggtctcctttcttctgttggcgaaagcaaacat
tgcttaacagacgccgtagaaaaggttccattctctatagaggcatgtacaagtacaact
tatgacgtaacaaaaatgcaaccacaactatttgtttgtaaatcatttgaagaattaacg
gaagcacttgagaaattcgctgaaacgatggcctttaaaacaggtggtaaagaaggctta
gaaaaagcaattcgctctgaaaaccatgcaaccgctgaattaaatagcggattacaaatt
acaggtacattcaccgagacaattgaaaacgatgcgggtgaattgatttatatgcgaaca
agttcgccaacagcattagccattcacaataaacagttagcgaatcattctacggctgta
cacagtgacggctttggaacaccgattggattactcactgaaaatattgccttagaaaat
tgtacagatgaacaactacaagcattaggaattacaattggaaatattgctgagtttact
tttgaaagtggtattcatgtaaaaggaacagtaatagatattgtaaaaaacgataataaa
atcgctcttatttcctttatcaattgtacggttacttataaagaccgcgttttatttgat
gcttcatggggcgcatttgatatggctgttggttcaacaatcacttccgtattcccaggt
gccgcagatgctgcagcatttttcccaatggatgaagaaattcaagaaattcctgctcca
cttgtactgaatgaacttgaacgtatgtatcaaacagttcgtgatatccgaaatgaaggt
attttacacgacgcacatatcgatcaattagtagcaattcaagaggtattaaacaaattt
tatgcgaaagaatggttacttcgccttgaaatattagaattgcttttagaacataacaaa
gggcacgaaacatcagcagcattattacaacaactttctactttcacaactgatgaagct
gtaacacgccttattaacaatggtcttacgctacttccagtaaaggatgtgaaaaatgat
gctacgattaactga

DBGET integrated database retrieval system