KEGG   Bacillus cereus 03BB102: BCA_4780Help
Entry
BCA_4780          CDS       T00869                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00010  Glycolysis / Gluconeogenesis
bcx00620  Pyruvate metabolism
bcx00640  Propanoate metabolism
bcx00680  Methane metabolism
bcx01100  Metabolic pathways
bcx01110  Biosynthesis of secondary metabolites
bcx01120  Microbial metabolism in diverse environments
bcx01130  Biosynthesis of antibiotics
bcx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCA_4780 (acsA)
   00620 Pyruvate metabolism
    BCA_4780 (acsA)
   00640 Propanoate metabolism
    BCA_4780 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BCA_4780 (acsA)
Enzymes [BR:bcx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCA_4780 (acsA)
Lipid biosynthesis proteins [BR:bcx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCA_4780 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FPRL1_inhibitor
Motif
Other DBs
NCBI-ProteinID: ACO26487
UniProt: A0A158RHL2
Position
complement(4465614..4467332)
Genome map
AA seq 572 aa AA seqDB search
MKVETLPVIKGENNLPNYDEAYANFNWEEVNKNFTWNETGRVNMAYEAIDKHAKSDRKNK
VALYYQDGSRKEKYTFKEMKDFSNKAGNVLKNYGDVEKGDRVFIFMPRSPELYFALLGAV
KLGAIVGPLFEAFMEGAVRDRLEDSEAKVLITTPELLERVPLNDLPALKTVFLVGDNVEE
GGKTVAFNPLFEQASKELHIEWLGREDGLILHYTSGSTGKPKGVLHAQNAMVQHYQTAKW
VLDLKEDDVYWCTADPGWVTGTAYGIFAPWLVGASNVILGGRFSPEAWYEALQDYGVTVW
YSAPTAFRMLMGAGQDAIKKYDLSQVRHVLSVGEPLNPEVIRWGMNAFGLRIHDTWWMTE
TGGQVICNYPCMEIRPGSMGKPIPGVKAAIVDNEGNEVPPYTMGNLAIGKGWPAMMRGIW
NNKQKYESYFMPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERVGPFEVESKLIEHA
AVAEAGVIGIPDPVRGEIIKAFIALRAGYEPSEELKEEIRQFVKKGLAAHAAPRQIEFRD
KLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaaacgcttcctgtcattaaaggagaaaataatttgccgaattatgatgag
gcatacgcgaattttaactgggaagaggttaataaaaactttacttggaatgaaacaggc
cgagtaaatatggcgtatgaagcaattgataagcatgcgaaatccgatcgaaagaataaa
gtagccctttattatcaagatggatctcgaaaagagaagtatacatttaaggaaatgaag
gatttttctaataaagcaggaaacgtcctaaaaaactatggcgatgtagaaaaaggcgat
cgcgtttttatttttatgccgcgttctccagagttatatttcgcacttcttggtgcagtg
aaattgggagcaattgttggtccactatttgaagcatttatggaaggcgcagttcgcgat
cgtttagaagatagcgaagcaaaagtgttaattacaacacctgaattgttagagcgtgta
ccattaaatgatttacctgctttaaaaacagtcttccttgttggagataatgtagaagaa
ggcggtaaaacagtagcattcaatcctttatttgaacaagcttcaaaagaattacatatt
gaatggttaggccgtgaagacggtttgattttacattacacgtctggttctactggtaag
ccgaaaggtgtgcttcatgcgcaaaacgccatggttcagcactatcaaacggcgaaatgg
gtattagatttaaaagaagacgatgtatattggtgcacagctgacccaggctgggtaacg
ggaacagcttacggtatttttgcaccgtggttagtcggagcatcaaatgttattttaggc
ggacgctttagtccagaagcgtggtatgaagcactgcaagattacggtgtaacagtttgg
tacagcgcaccaacagcgttccgtatgttaatgggtgccggacaagatgcaattaaaaaa
tatgatttatcacaagtacgccacgtgttgagcgttggtgaaccgttaaatccagaagta
attcgctggggtatgaacgcatttggacttcgtattcatgatacgtggtggatgacagaa
acaggtggacaagttatttgtaactacccttgtatggaaatccgtccaggttcaatgggt
aaaccaattccaggtgtgaaagcagcgattgttgataatgaaggaaatgaagtgccacca
tacacaatgggtaacttagcaattggtaaaggttggccagcgatgatgcgtggaatttgg
aataacaagcaaaagtatgagtcttactttatgccgggcgattggtacgtatcaggtgac
tctgcctatatggacgaggatggatacttctggttccaagggcgtattgacgatgtaatt
atgacgtcaggtgagcgcgttggtccgtttgaagtggaaagcaaattaatcgagcatgct
gctgttgcagaagctggtgtaattggtattcctgatccagtgcgcggagaaatcattaaa
gcatttatcgcgcttcgagcaggatacgaaccatctgaagaattaaaagaagaaattcgt
caatttgtaaagaaaggtctagcagctcatgcagcgccaagacaaattgaatttagagat
aaattaccgaaaacgagaagcggtaaaattatgcgccgcgtattaaaagcgtgggagtta
aacttaccaacaggtgacttatcaacgatggaagattaa

DBGET integrated database retrieval system