KEGG   Bacillus cereus 03BB102: BCA_4887Help
Entry
BCA_4887          CDS       T00869                                 

Definition
(GenBank) putative molybdenum cofactor biosynthesis protein B
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
bcx  Bacillus cereus 03BB102
Pathway
bcx00790  Folate biosynthesis
bcx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCA_4887
Enzymes [BR:bcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     BCA_4887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth MazG_C
Motif
Other DBs
NCBI-ProteinID: ACO26665
UniProt: A0A158RI30
Structure
PDB: 

Position
complement(4560328..4560837)
Genome map
AA seq 169 aa AA seqDB search
MSVTEHKKQAPKEVRCKIVTISDTRTEETDKSGQLLHELLKEAGHTVTSYEIVKDDKESI
QQAVLAGYHKEDVDVVLTNGGTGITKRDVTIEAVSALLHKEIVGFGELFRMISYLEDIGS
SAMLSRAIGGTIGRKVVFSMPGSSGAVRLAMNKLILPELGHITFELHRQ
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtaaccgaacataaaaaacaagcgcccaaagaagtgcgctgcaagatcgtaaca
atttccgatacacgtacagaagagacagataagagcggtcaactattacatgaattgtta
aaagaagcaggccatacagtgacttcttatgaaattgtgaaagatgataaagaaagtatt
cagcaagcagtgttagctggttatcataaggaagatgtagatgttgtattaacaaatggc
ggaactggtattacgaagcgtgatgttacaattgaagcagtatcagcgttattacataaa
gaaattgttggatttggtgagttgttccgcatgattagttatttagaagatatcggaagc
agcgccatgttaagtagagcgatcggcggcacaattgggcgcaaagtagtcttttcgatg
ccagggtctagcggagcagttcgccttgcgatgaataaattaattttaccagaactaggt
catattacatttgagctgcatcgccaatga

DBGET integrated database retrieval system