KEGG   Bacillus cytotoxicus: Bcer98_0014Help
Entry
Bcer98_0014       CDS       T00560                                 

Definition
(GenBank) deoxynucleoside kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00230  Purine metabolism
bcy00240  Pyrimidine metabolism
bcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bcer98_0014
   00240 Pyrimidine metabolism
    Bcer98_0014
Enzymes [BR:bcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     Bcer98_0014
    2.7.1.76  2'-deoxyadenosine kinase
     Bcer98_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_15 AAA_33 SKI TsaE Cytidylate_kin2 AAA_28 AAA_29 CbiA RNA_helicase ABC_tran AAA_25 RsgA_GTPase ParA AAA_16 MMR_HSR1 NB-ARC AAA AAA_22 ArgK ArsA_ATPase
Motif
Other DBs
NCBI-ProteinID: ABS20389
UniProt: A7GJT1
Position
complement(22591..23259)
Genome map
AA seq 222 aa AA seqDB search
MNFRQKYDIPNDAVITIAGTVGVGKSTMTTALANALSYRTSFEKVDSNPYLDKFYDDFTR
WSFHLQVYFLAERFKEQKKIFEYGGGFIQDRSIYEDTGIFAKMHYEKGTMTETDYETYKS
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQKRGRPMEQQTPIEYWKEMHERYENWINN
FNSCPVLRLNINEYDVLQDENSIEPIIKKIGHFLNQTHRLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaggcaaaaatacgatatacccaatgatgcagtaattactatcgctggaact
gtcggtgtaggaaaatcaacaatgaccacagcacttgctaatgctttaagctatcgaaca
tcatttgaaaaggtagattcaaatccttacttagacaaattttatgatgattttacacgt
tggagttttcatttacaagtttatttcttagcagagcgatttaaagaacaaaaaaaaatt
tttgaatatggcggaggctttatccaagatcgttctatttatgaagacactggcattttc
gcgaagatgcactatgaaaaagggacaatgacagaaacagattatgaaacatataaaagc
ctgtttgatgcaatggtaatgacaccttattttccgcatccagacctattaatttattta
gaaggttcttttgatgatattgttgatcgtattcaaaaaaggggacgcccgatggagcaa
caaacgccaattgaatattggaaggaaatgcatgagcgttatgaaaattggattaataac
tttaactcctgccctgtcctacgtttaaatattaatgaatacgatgttctacaagatgaa
aattccattgaaccaattattaagaaaatcggacatttcttaaaccaaacacatagactt
gtaaaataa

DBGET integrated database retrieval system