KEGG   Bacillus cytotoxicus: Bcer98_0195
Entry
Bcer98_0195       CDS       T00560                                 

Definition
(GenBank) ABC-2 type transporter
Organism
bcy  Bacillus cytotoxicus
SSDB
Motif
Pfam: ABC2_membrane_3 DUF3533 ABC2_membrane NTS DUF3412 DC_STAMP
Other DBs
NCBI-ProteinID: ABS20562
UniProt: A7GKA4
Position
205286..206464
AA seq 392 aa
MQVCTCLLEGVGKMNTLKQFLRVPGTYIGIGVALAFQLIFFCVWLTAYDGVNERADKLQI
AIVNQDTSMGSKIGDGLQKSLPFQVTKEKSMEKAKEEMDQYAYNMIIEIPASFSKDISEK
GKTDLNVHINQASSMMAKQMMESIAKQVHSNVNKEITNNKQQAIAGKLQAVGPESIEMLK
GLTKESVGLKVHKVNDAKGFSVNMVPLMIVLASFVGAMIMSMELSKVAKQVGRDWRNFLS
SQVINGVVSILLACMTIGLMKTFHIGIQETIGNVWIFQTIVFFAFLSLTQMFLTLFGNAG
MIFNIISLSLQLVSSGVMVPQAMLSKTYQIIGELFPATYAVKGYFAIIFGGGNLSVNIIS
LLFIILITQIVALSVVGISFIVKRERAVGKDM
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgcaagtatgtacttgcttgctagaaggggttgggaaaatgaatacgttgaaacaattt
ttaagagtaccaggtacgtatatagggattggagtagctttagcattccagctcattttc
ttttgtgtttggctaacagcttatgatggagtcaatgaaagagcagataaactgcaaatt
gcgattgtaaaccaagatacgagtatgggaagtaaaataggagacggtttacagaaaagt
ttaccttttcaagtgacaaaagagaagtctatggaaaaggcaaaagaagaaatggatcag
tatgcatacaatatgattattgaaattccagcctctttttcaaaggatataagcgaaaaa
ggtaagacagatttaaacgttcatattaaccaagccagctcgatgatggcaaagcagatg
atggaaagcatagcaaaacaagttcatagcaatgtaaataaagaaattacaaacaataaa
caacaagctattgcaggaaagttacaagctgtggggccagagagcattgaaatgttaaag
gggctaacaaaagaatcagttggacttaaagtgcacaaagtaaatgatgcaaaagggttt
tccgtaaacatggtgccgcttatgattgtgttagcttcattcgttggagcgatgattatg
agtatggaattatcgaaagtggcaaaacaagtaggaagagattggagaaattttctttca
agccaagtgattaacggtgtagtatctattctacttgcatgtatgaccattggcttaatg
aaaacttttcacatcggaatccaagaaacgattgggaatgtatggatatttcaaaccatt
gtcttttttgcttttctatcattaacgcaaatgtttcttactctattcggaaatgcaggt
atgatttttaatattatatcactctcgttgcaacttgtaagttctggtgtaatggtcccg
caggctatgttatccaaaacatatcaaataatcggagaattatttcccgcaacttatgct
gtgaagggttattttgcaataatatttggtggtgggaatttaagtgtaaatattatttct
ctattatttataattttgattacacaaattgtagcactaagtgtagtagggatatcattt
atagtaaagagagaaagggctgtaggaaaagacatgtaa

DBGET integrated database retrieval system