KEGG   Bacillus cytotoxicus: Bcer98_0853Help
Entry
Bcer98_0853       CDS       T00560                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00620  Pyruvate metabolism
bcy00630  Glyoxylate and dicarboxylate metabolism
bcy01100  Metabolic pathways
bcy01110  Biosynthesis of secondary metabolites
bcy01120  Microbial metabolism in diverse environments
bcy01200  Carbon metabolism
Module
bcy_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcer98_0853
   00630 Glyoxylate and dicarboxylate metabolism
    Bcer98_0853
Enzymes [BR:bcy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcer98_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABS21188
UniProt: A7GM30
Position
969280..970869
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLAGELLPSYNEILTPEALTFLKELHENFNERRIQLLKKREEKQKRIDAGEF
PNFLPETAHIRAGNWTIAPLPRDLEDRRVEITGPVDRKMIINALNSGAHLFMADFEDSSS
PTWKNIIEGQINLRDAAKGTISYKSPSGKEYRLGDQTAVLIVRPRGWHLEEKHMQVDGKR
MSGSLVDFGLYFFHNAKTLIEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYVGIPNGTI
KATVLLETIHAAFEMDEILYELRDHSAGLNCGRWDYIFSFLKCFRNHKAFLLPDRAQVTM
TVPFMRAYSLKVIQTCHRRNAPAMGGMAAQIPIKNNPEANEIAFEKVRVDKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREELHVTEKDLLEVPMGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEEGKLNDGRKVTFALVEQLK
AEELAKIEKEIGKESFEKGRFVEATKLFTDLVRKDEFEPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgcaaacttcacgagtgacactcgctggagaattattaccatcgtacaacgaa
attttgacaccagaagcgcttacttttttgaaagagttgcatgagaatttcaatgaacgt
cgtattcagttattaaagaaacgagaagaaaaacagaaaagaattgatgcgggagagttt
ccgaattttttaccagaaacagcacatatacgtgcgggcaattggacaattgcgccgctt
ccgcgtgatttagaagatcgacgcgtagagattacgggacccgtagatcgaaagatgatt
attaatgctttaaactctggggcacatctttttatggcagattttgaagactcgagttca
ccaacatggaaaaacataatagaaggtcaaataaacttaagagatgctgcgaaaggaacg
atttcatataagagcccaagtgggaaagaataccgtcttggcgatcaaacagctgtactt
attgtacgtccgcgcggttggcatttagaagaaaagcatatgcaagttgacgggaaacgt
atgtcaggaagtcttgtagactttggactgtactttttccataatgcgaaaactttaatt
gaaaaaggaagcggtccatatttttacttgccaaagatggagagctatttagaggctcgt
ttatggaatgatgtatttgtatttgcacagaagtatgtcggtattccaaatggcacaatt
aaagcgacggtactgcttgagacgatccatgctgcatttgaaatggatgaaattttatat
gaattacgtgatcactccgctggattaaattgtggacgatgggattatatctttagcttt
ttaaaatgtttccgcaatcataaagcatttttgcttccagacagagcacaagttacgatg
acagtaccgtttatgcgcgcgtattctttgaaagtcattcaaacgtgtcaccgccgaaat
gcaccagcgatgggggggatggcagcgcaaattccaattaaaaataatccagaggcgaat
gaaatcgcctttgaaaaagtgcgggtcgataaagagcgcgaagctttagatgggcatgat
ggaacttgggttgctcatccagggctcgtaccagttgcgatggaagtatttaatcacatt
atgaaaacaccaaatcaaatatttagaaaacgggaggaactgcatgtaacagaaaaagat
ttattagaagtacctatgggaacgattacagaagaagggctgcgcatgaatatcagtgtt
ggcattcaatatattgcgtcatggctaagtggacgcggggcagcacctatttataactta
atggaagatgcggcaacagcggaaatatcaagagcgcaagtttggcagtggattcgtcat
gaggaggggaaactgaatgacggtcgtaaagttacgtttgctttagtagaacaattgaag
gcggaagaactagcgaaaatagagaaggagattggaaaagaatcatttgagaaaggtaga
tttgtagaagcgacaaagttatttactgatttagtgcgtaaggatgagtttgaaccattt
ttaacattacctggttatgaaattttataa

DBGET integrated database retrieval system