KEGG   Bacillus cytotoxicus: Bcer98_1102Help
Entry
Bcer98_1102       CDS       T00560                                 

Definition
(GenBank) aminoglycoside phosphotransferase
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bcy  Bacillus cytotoxicus
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bcy01504]
    Bcer98_1102
Enzymes [BR:bcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     Bcer98_1102
Antimicrobial resistance genes [BR:bcy01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    Bcer98_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase Kdo
Motif
Other DBs
NCBI-ProteinID: ABS21428
UniProt: A7GMS0
Position
complement(1214472..1215383)
Genome map
AA seq 303 aa AA seqDB search
MYEFFSTIYTTSLPHLHIDSFQQNESGWDHIAIIINNALLFRFPREATIAKRIPLEKELC
SLLAKSLHDIEIPNYHLFYTNESDTIPTCSYYTLIYGEPLTAQMIANLTIQEREQVITQI
AQFLATLHTISLEHATQLGFKIEKTITYWKQLQMKLNRYLSHTFIKCEKEAFDKLFHQFF
TLFHRYDLQYTMIHADFTHHHILFDEKRKKVSGIIDFGDTQIRDPAFDFAGLYHDFGNVF
TEDVYKKYCTLILHHDSSFMQRIISFYQHSPLLHQLLYNLERKDEHAIHNGLKKLRTMLQ
GLN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaattcttttcaacgatatatacaacaagccttccgcatttacatatagattct
tttcaacaaaatgaaagcggctgggatcatatagcgattattataaataacgctttgctt
tttcgctttcctagggaagccacgattgcaaagagaattccgctagaaaaagaactttgt
tccctcttagctaagtctttacatgatattgaaattcctaattatcacctgttctataca
aatgaatcagacactattccaacttgtagttactatacgctcatttacggagagccctta
acagctcaaatgattgctaacttaaccatacaagagcgcgaacaagtaattacacaaatt
gctcaatttcttgcgactttacatactatttcactagaacatgctacacaattaggattt
aaaatagaaaaaacaatcacctactggaaacaactacaaatgaaattaaatcgttacctt
tcccatacattcataaaatgcgaaaaagaggcctttgacaaattgtttcatcaatttttc
acacttttccatcgatacgacttacagtatacaatgattcatgccgattttactcatcat
catattttattcgatgagaagcgtaaaaaggtttctggaattattgattttggcgataca
caaattagagatcctgcctttgattttgctggtttatatcatgattttgggaatgtattt
accgaagatgtttataaaaaatactgtacccttatccttcatcatgattcgtccttcatg
caacgcattatttctttttatcagcatagtcctttacttcatcagctcctttacaatttg
gaacgaaaagatgaacacgcaatacataatgggttgaaaaaattacgaaccatgctgcag
ggattgaattag

DBGET integrated database retrieval system