KEGG   Bacillus cytotoxicus: Bcer98_1149Help
Entry
Bcer98_1149       CDS       T00560                                 

Definition
(GenBank) cobalamin (vitamin B12) biosynthesis CbiX protein
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00860  Porphyrin and chlorophyll metabolism
bcy01100  Metabolic pathways
bcy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcer98_1149
Enzymes [BR:bcy01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Bcer98_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK Ferrochelatase
Motif
Other DBs
NCBI-ProteinID: ABS21474
UniProt: A7GMW6
Position
1259558..1260310
Genome map
AA seq 250 aa AA seqDB search
MKAVLYICHGSRLKAAKEEAIQFVTSCMSHIHASVQEVCFLELASPSIEEGIAACIKRGA
TKIIVIPVFLLAAGHVKKDIPYELQKIKNKYENLEIVYGDAFGVSDSLILAAYKESGLEE
YQEEATLLLVARGSSEPEIVENMREIAFLFQQQKNVKTVEVCYLAATEPRFEDKLQEIIE
RKEKHIVVLPYLLFTGLLMKHIEQEVSKYQNADIHISPYLGKNPTVRNMLIQKTERLLRS
DQYVSTYSSN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtgctgtatatatgtcatggaagtagattaaaagctgcgaaagaagaggcg
atacagttcgttacttcttgtatgagtcacattcatgcgtctgttcaagaagtttgcttt
ttagagttggcaagtccatccattgaagagggaattgctgcttgtataaaaagaggagca
acaaaaattattgtcataccagtttttctattagcagcaggacatgtaaaaaaagatatt
ccatatgaattacaaaaaataaaaaataaatatgagaatcttgaaattgtatatggtgat
gcatttggagtatctgattcgcttattttagccgcttataaagaaagtggtttggaagaa
tatcaggaagaagcaacgcttttactagtagcaaggggaagtagtgagccagaaatagta
gagaatatgagggagattgcgtttttatttcagcagcagaagaatgtgaaaacggtggaa
gtatgctatttagctgcaacagagccaagatttgaagataaattacaagaaataatagaa
agaaaagaaaagcatatcgtcgttttgccttatttattatttacaggactgttaatgaaa
catattgaacaagaagtaagtaaatatcaaaatgcggatatacatataagtccgtactta
ggaaagaatcctacagttcgaaatatgctaattcaaaagacagaacggctattaaggagc
gatcaatatgtatccacttacagttcgaattga

DBGET integrated database retrieval system