KEGG   Bacillus cytotoxicus: Bcer98_2722Help
Entry
Bcer98_2722       CDS       T00560                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00071  Fatty acid degradation
bcy00072  Synthesis and degradation of ketone bodies
bcy00280  Valine, leucine and isoleucine degradation
bcy00310  Lysine degradation
bcy00362  Benzoate degradation
bcy00380  Tryptophan metabolism
bcy00620  Pyruvate metabolism
bcy00630  Glyoxylate and dicarboxylate metabolism
bcy00640  Propanoate metabolism
bcy00650  Butanoate metabolism
bcy00900  Terpenoid backbone biosynthesis
bcy01100  Metabolic pathways
bcy01110  Biosynthesis of secondary metabolites
bcy01120  Microbial metabolism in diverse environments
bcy01130  Biosynthesis of antibiotics
bcy01200  Carbon metabolism
bcy01212  Fatty acid metabolism
bcy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcer98_2722
   00630 Glyoxylate and dicarboxylate metabolism
    Bcer98_2722
   00640 Propanoate metabolism
    Bcer98_2722
   00650 Butanoate metabolism
    Bcer98_2722
  Lipid metabolism
   00071 Fatty acid degradation
    Bcer98_2722
   00072 Synthesis and degradation of ketone bodies
    Bcer98_2722
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcer98_2722
   00310 Lysine degradation
    Bcer98_2722
   00380 Tryptophan metabolism
    Bcer98_2722
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcer98_2722
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcer98_2722
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcer98_2722
Enzymes [BR:bcy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcer98_2722
Exosome [BR:bcy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcer98_2722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABS22956
UniProt: A7GS48
Position
complement(2809361..2810536)
Genome map
AA seq 391 aa AA seqDB search
MQNVVITAAVRSPIGTFGGALKNITPVELVVPVLQEAVKQGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPETVTGYTIQRQCSSGMQAIMSAAMQIQLGISDVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPLHHMMMGETAENLVEQYNITREEQDEIALR
SHRLALQAIESGYFDKQIVPITIKERRKEVVFSKDEHPRADITAEKLANLKPAFRKGGSV
TAGNASGINDGSAVLVVMSEEKAKEKGLQPLAKVVGYSVAGVDPKIMGIGPAPAIRKGLK
KVNWSLEDADLLEINEAFAAQYLAVEKELGLNREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLKKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgttgtgattacagcagcagttcgttcaccaatcggaactttcggaggagcg
ctcaaaaatataacaccagtagaattagtggttcctgtacttcaagaagctgtaaagcaa
ggtggagtagagccacatgaagtggatgaagtcattttaggacactgcattcaacgaacg
gatgaggcaaatacagcgcgaacagctgcattagcagcaggatttccagaaacagttaca
ggctatacgattcagcgtcaatgttcttcagggatgcaagcgattatgtctgcagcaatg
caaattcagttaggtattagtgatgttgtcgttgcaggcggagtagaggcgatgagctct
agcccctatgcgttaaaacagcaccgctggggacagcgtcttcagcacggcgaaattcgt
gatacggtgtgggaagttttagaagaccctcttcatcatatgatgatgggtgaaacggca
gaaaatttagtggaacaatataacattacaagagaggaacaagatgaaattgcgctgcgt
agccatcggctagctcttcaagctattgaatctggttattttgataaacaaattgtgccg
attacaataaaggaacgaagaaaagaagttgtgttttcgaaggatgaacatccgcgtgct
gatattacagcggaaaagctagcaaatttaaaaccagcatttcgtaaaggcggttctgta
acggccggaaatgcatcaggtattaatgatggtagcgccgttttagtagtaatgagtgaa
gagaaagcgaaagaaaaaggattgcaaccattagcgaaagttgtaggatattcagtagcc
ggagtagatcctaaaattatgggaattggtccagcgccagcaattcgtaaaggattaaaa
aaagtgaattggtcgctggaagatgccgacttactagaaattaatgaagcttttgcggct
caatatttggcggtcgaaaaggaactcggtttaaatcgtgaaaaagtaaatgtgaatggt
agtggtgtaggtcttggtcatccaattggatgcacaggagcacgcattacggtaagctta
attcatgaattaaaaaggcgaggtcttaaaaagggaattgcttccctttgtgttggtggc
ggtattggcgtagcattatttatagaagcattataa

DBGET integrated database retrieval system