KEGG   Bacillus cytotoxicus: Bcer98_2736
Entry
Bcer98_2736       CDS       T00560                                 

Definition
(GenBank) 2,3-diketo-5-methylthio-1-phosphopentane phosphatase
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00270  Cysteine and methionine metabolism
bcy01100  Metabolic pathways
Module
bcy_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bcer98_2736
Enzymes [BR:bcy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     Bcer98_2736
SSDB
Motif
Pfam: HAD Put_Phosphatase HAD_2 Hydrolase
Other DBs
NCBI-ProteinID: ABS22969
UniProt: A7GS61
Position
2821775..2822434
AA seq 219 aa
MSIQIFCDFDGTITNSDNITSIMEHFAPPKAEEIKKQILAQELSIQEGVEQLFHLLPTNL
HDDMIAFLKNNASIRSGFQEFVQFINKNDLSFYVILGGMDFFVHPLLDGLVPKEKIYCNE
TDFSKEYIEVKWPYPCDKHCNHHCGLCKSTLIRRLSSQQDFRIVIGDSITDLQAAKQADK
VFARDFLITKCKEYHIPYTPFHTFYDIQNELQHLVEVKL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagcattcaaattttctgcgactttgatggcacaattacaaatagcgacaatatcact
tctattatggaacatttcgcgccaccaaaggctgaggaaataaagaaacagatattagct
caagagctttcgattcaagaaggggttgagcaactttttcatttattaccgaccaatctc
catgacgatatgattgcatttttaaaaaacaacgcaagtatacgtagtggttttcaggaa
tttgtacagtttataaataaaaatgacctttctttctatgtcattttaggaggaatggat
ttctttgtgcacccccttttagatgggcttgttccaaaagaaaagatttattgtaatgaa
actgacttttcaaaagaatacattgaagtaaaatggccatatccttgcgataaacattgt
aatcatcattgtggtctctgtaaatccacactgattcgaaggcttagctctcaacaagat
tttcgcattgtcattggtgattctattacagatttgcaagcagctaagcaagctgataaa
gtattcgcacgtgattttctcattacaaagtgcaaagaatatcatattccttatacacca
tttcatacattttatgatattcaaaacgagttgcagcacttggtggaggtaaaactatga

DBGET integrated database retrieval system