KEGG   Bacillus cytotoxicus: Bcer98_3003Help
Entry
Bcer98_3003       CDS       T00560                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bcy  Bacillus cytotoxicus
Brite
Enzymes [BR:bcy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Bcer98_3003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N OST-HTH
Motif
Other DBs
NCBI-ProteinID: ABS23230
UniProt: A7GSX2
Position
complement(3052538..3053149)
Genome map
AA seq 203 aa AA seqDB search
MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYVTNLNAALEGHAELADKSVEELVA
NLNEVPEEIRTAVRNNGGGHANHSFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKAEF
AKAGASRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTPIIGLDVWEHAYYLHYQNRRP
DYISAFWNVVDWNAAEKRYQEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacatgaattaccaaatttaccttatgcgtatgatgcattagagcctcatttt
gacaaagaaacaatgaacatccatcatacgaaacaccacaatacgtacgtaacaaactta
aatgctgcattagaaggtcacgcagaattagctgacaaaagtgttgaagaattagttgca
aatttaaacgaagtaccagaagaaattcgtactgcagtacgtaacaatggtggtggacat
gcaaaccatagcttcttctggacaatcttatctccaaatggcggtggacaaccagtaggt
gaacttgctactgcaattgaagcaaaattcggtagctttgatgcattcaaagcagaattt
gcaaaagctggtgcatctcgattcggttctggttgggcttggttagtagtaaacaacggt
gaactagaagtaacaagtactccaaaccaagattcacctttaacagaagggaaaacacca
atcatcggtttagatgtttgggagcatgcttactacttacattaccaaaaccgccgtcct
gattacatcagtgcgttctggaatgttgtagactggaatgcagctgaaaaacgttaccaa
gaagctaaataa

DBGET integrated database retrieval system