KEGG   Bacillus cytotoxicus: Bcer98_3661Help
Entry
Bcer98_3661       CDS       T00560                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcer98_3661
Enzymes [BR:bcy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bcer98_3661
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bcer98_3661
    1.1.1.-  
     Bcer98_3661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc Mg_trans_NIPA Cas_csx3
Motif
Other DBs
NCBI-ProteinID: ABS23858
UniProt: A7GUQ0
Position
complement(3719458..3720480)
Genome map
AA seq 340 aa AA seqDB search
MKAAVWYGEKDIRIEEREVKELQPNDVKVKVAWTGICGSDLHAYLHPDSVPMNRNMVLGH
EFSGEIVEVGSHVTKFKEGDRVCIYPMMLKDPSNAEIERFITLDAVGAQIDGGFAEYAIL
PQKTIFKIPDTLPLELAAMVEPAAVSFQSVKDSNVKEGDTIVVYGAGPIGLFAVLGAKAA
GVSNIIVVDLLDSRLDKATELGATHVFNAREVNPVEEIRKLFPDGADVVFEAAGVESTFN
QAIQSTKVRGTMMVISFHTQDIQFNAPSSLLFSGVKLMGSVGYSNETYNEVIELLANGRL
PAQSIITSKVDIDNIAEQGFEALIHDKSQAKILVKLSGAH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagtatggtatggtgaaaaagatattcgtattgaggaaagagaagtgaaa
gaattacaacccaatgatgtgaaagttaaagtagcatggactggtatttgtggttctgat
ttacatgcatacttgcatccggattcagtgccaatgaataggaatatggtactcggacat
gagttttctggtgaaattgtagaggtaggttctcatgttacgaaatttaaagaaggtgac
agagtatgtatctatccaatgatgcttaaagatccttcaaatgctgaaattgaacgtttc
atcactttagacgcggttggagcacaaatcgacggagggtttgcagaatacgcgatactt
ccacaaaaaacgatttttaaaattccagatactttaccactagaattagcagcaatggta
gaaccagcagctgtatcttttcaatcagttaaggattcaaatgtaaaagaaggagatact
attgttgtctatggcgcaggtcctatcgggctatttgctgtattaggggcaaaagctgca
ggtgtttctaatattattgttgtcgatttattggatagtcgactcgacaaagcaactgaa
ttgggtgcaacacacgtctttaatgctagagaagtgaaccctgttgaagaaattcgtaaa
ttattcccagatggagcagatgttgtatttgaagctgcaggtgttgagtcaacatttaat
caagccattcaatcaactaaagttcgtggcacaatgatggttatcagctttcacacccag
gatatccaatttaatgctccttcatccctactctttagcggcgtaaaattaatgggatct
gtgggatatagcaatgaaacttataacgaggtcattgaattacttgctaatggaagatta
ccggcgcaatcaattattacaagtaaagttgatatagataatattgctgaacaaggcttt
gaagcattaattcatgataagtctcaagcaaagattctagttaaattaagtggcgcacat
taa

DBGET integrated database retrieval system