KEGG   Bacillus cereus E33L: BCE33L0747
Entry
BCE33L0747        CDS       T00198                                 

Gene name
katB
Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00380  Tryptophan metabolism
bcz00630  Glyoxylate and dicarboxylate metabolism
bcz01100  Metabolic pathways
bcz01110  Biosynthesis of secondary metabolites
bcz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BCE33L0747 (katB)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BCE33L0747 (katB)
Enzymes [BR:bcz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BCE33L0747 (katB)
SSDB
Motif
Pfam: Catalase Catalase-rel Catalase_C
Other DBs
NCBI-ProteinID: AAU19496
UniProt: Q63FG1
Position
complement(846806..848791)
AA seq 661 aa
MEQLEHHVTDNQRKHALTTNQGVKIAEDEFSLKMGLRGPTLMEDFHFREKMTHFDHERIP
ERIVHARGVGAHGYFQLYESLEAYTKADFLTNPSKKTPVFVRFSTVQGSKGSNDTVRDVR
GFATKFYTDEGNYDLVGNNMPVFFIQDAIKFPDFVHAVKPEPHNDIPQGASAHDTFWDFV
AHNPESTHMVMWQMSDRAIPRSLRMMEGFGVHTFRLINKEGKAHFVKFHWKPTLGVHSLV
WDEAQRIAGKNPDFHRQDLYEAIEKGDYPEWELGLQLIPEEDEHAFDFDILDPTKLWPEE
EVPVKLVGKMTLNKNVDNFFAETEQVAFHPGHVVPGIDFSNDPLLQGRLFSYTDTQLSRL
GGPNFHQIPINQPVCPFHNNQRDGMHQMQIHRGQTSYHPNGLNDNQPATVQAEQGGYEHY
QEKIDGHKIRGRSKSFLNFYSQAKLFYNSMSPIEKQHIKDAFCFEVGKCKSDMVKANVIT
LLNHVDRQLAKEVANIIGAPLPKENHEVNSDAKSPALSMSNTICKSDSKNVAILLNGDPS
VSLLSEWIQAFAQHRINYGIIDKKIYHFTDSIKVTDTYTTADSSLFDAVLVFSSESVIHS
PVLEFAETTFKHFKPIAHVLSNPHALDNSKIKLDGAGIYNLANTSIESFIEGIAQGRFWN
R
NT seq 1986 nt   +upstreamnt  +downstreamnt
atggagcaattggaacaccacgttacggataatcaacgcaaacatgctttaacaacaaac
caaggagtaaaaatagccgaagatgaattttctttaaagatgggcttaagaggcccaact
ttaatggaggatttccactttcgcgagaaaatgacccactttgatcacgagcgaattccc
gaaagaattgttcatgcacgcggagttggcgctcatggttattttcagctttatgaatcg
ttagaagcatatacaaaagcagattttcttactaatccttcaaaaaaaacacctgtattt
gtgcgcttctcaaccgttcaaggctctaaaggatccaatgacacagtaagagatgtgcgc
ggatttgccacaaaattttatacagatgaaggtaactatgatttagtaggtaataatatg
ccagtattctttatccaagatgctattaaattccctgattttgtacatgcagttaaacca
gaaccacataatgatattcctcagggagctagcgctcatgatacattttgggattttgtt
gcgcataatcccgagtctactcatatggtgatgtggcagatgagtgatcgcgcaattccg
cgtagtttacgaatgatggaaggttttggggttcatacatttcgactcattaataaagaa
ggaaaagcccacttcgtaaagtttcactggaaacctaccctaggggttcattcattagta
tgggatgaagctcaaaggattgccgggaaaaatcctgatttccatcgtcaagatttatac
gaagcaattgaaaaaggcgattatccggaatgggagcttggattacagttaattccggaa
gaagatgagcatgcatttgattttgatattttagatccaacgaaattatggccagaagaa
gaagttcctgtaaaactagttggtaaaatgacattgaacaaaaatgttgataacttcttt
gcagaaacagaacaggtagctttccaccctggtcatgtcgtaccaggtattgatttttca
aatgaccctcttctgcaaggaagattgttctcctatacagatacacaattatctcgttta
ggaggtcctaatttccaccaaattcctattaaccagcctgtatgtccttttcataataat
caacgtgatggtatgcatcaaatgcaaattcatcgcggtcaaacaagctatcatcctaat
ggcttaaatgataatcaaccagcaaccgtccaagccgaacagggcggatatgagcattat
caagaaaagattgatggacataaaattagaggccgcagtaaaagcttccttaacttttat
tcgcaagctaaacttttctacaatagtatgagccctattgaaaagcagcacataaaagat
gcattttgctttgaagttgggaagtgcaaatcagacatggtgaaggcaaatgtaattact
ctactgaatcatgtcgatcgtcaattagcaaaagaagttgctaacattattggagctccc
ttgcctaaggaaaatcacgaagtaaattcagatgcaaaatcacctgcactaagtatgtcc
aatactatttgtaaatcggattccaaaaatgttgcaattctattaaatggtgacccaagc
gtctcccttctgtccgaatggattcaagcttttgcacaacaccgaattaactatggcatc
atagataagaaaatttatcatttcactgattctattaaagtaacggatacttatacaaca
gcagactcttccctttttgacgcagtattagtgtttagtagtgaatctgtcattcactcc
cctgttttagaatttgcagaaactacttttaaacattttaaaccgatagctcatgtcctt
agtaatcctcatgctttggacaatagtaaaattaaattagatggagcaggaatttacaac
ttagcaaacacttcaattgaatcatttatagaaggcattgcccaaggacgattttggaat
cgataa

DBGET integrated database retrieval system