KEGG   Bacillus cereus E33L: BCE33L2342Help
Entry
BCE33L2342        CDS       T00198                                 

Definition
(GenBank) acetamidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00330  Arginine and proline metabolism
bcz00360  Phenylalanine metabolism
bcz00380  Tryptophan metabolism
bcz00627  Aminobenzoate degradation
bcz00643  Styrene degradation
bcz01100  Metabolic pathways
bcz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BCE33L2342
   00360 Phenylalanine metabolism
    BCE33L2342
   00380 Tryptophan metabolism
    BCE33L2342
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCE33L2342
   00643 Styrene degradation
    BCE33L2342
Enzymes [BR:bcz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BCE33L2342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdA_AmdA Ribosomal_S7
Motif
Other DBs
NCBI-ProteinID: AAU17918
UniProt: Q63AY6
Position
2474047..2474961
Genome map
AA seq 304 aa AA seqDB search
MYRIHKEHIIYAMSPENKPCMEVEIGSRLIFETYDCFENQIDSEDVAFQELDWNRINPAT
GPVYINGAEPGDILAVTIEKIQIAEQGVLTTGMNLGVMGEELHENTVKIVPIHNKHVLFS
NELQIPINPMIGVIGTAPQEESISCGTPHDHGGNMDCKEIKEGTTLLLPVNVPGALLALG
DLHAAMGDGEIGVSGVEVAGEVTVTVHIIKGKKWPLPMAIQKEKIMTLASEKLLDDAANR
AVRNMVTFLHEELQMSKADATLLLSAAGDLKVCQVVDPLKTARMELSMDYVEKLGFNYSK
CHIK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaattcataaagaacatatcatttatgcaatgtcaccagaaaataaaccatgt
atggaagtagaaattgggagtcgccttatatttgaaacatatgattgctttgaaaatcaa
attgattctgaagatgttgcgtttcaagaattagattggaaccgaattaatccggcgact
ggacctgtatatatcaatggtgcagagcctggtgacatattagcggtaacgattgaaaag
attcaaattgcagagcaaggtgttttaactacaggtatgaatcttggtgtaatgggtgaa
gagctacatgaaaatacagtgaaaattgtcccaatacataataaacatgttttgttttcg
aatgaactacaaatcccaattaatccaatgatcggtgtaattggaactgctccacaagaa
gagagtatttcatgtggtacaccgcatgatcacggcgggaatatggactgtaaagagata
aaagaagggacaacattattattacctgtaaatgttcctggtgctctattagcattaggt
gatttacacgcagcgatgggtgacggtgaaattggtgttagtggagtagaggttgctggt
gaggtgacggtaacagttcatattataaaaggaaagaaatggccattaccaatggctatt
caaaaagaaaaaataatgacgcttgcttcagagaaattgctagatgatgcagcgaatcgt
gctgtacgtaatatggtgacatttttacatgaagaattacaaatgtctaaagctgatgcc
acgcttttattatcagctgccggtgatttaaaagtttgtcaagttgtggatccacttaaa
acagcacgaatggaattaagtatggattatgtggagaagctaggttttaattacagtaaa
tgtcatattaagtaa

DBGET integrated database retrieval system