KEGG   Bacillus cereus E33L: BCE33L3329Help
Entry
BCE33L3329        CDS       T00198                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00071  Fatty acid degradation
bcz00072  Synthesis and degradation of ketone bodies
bcz00280  Valine, leucine and isoleucine degradation
bcz00310  Lysine degradation
bcz00362  Benzoate degradation
bcz00380  Tryptophan metabolism
bcz00620  Pyruvate metabolism
bcz00630  Glyoxylate and dicarboxylate metabolism
bcz00640  Propanoate metabolism
bcz00650  Butanoate metabolism
bcz00900  Terpenoid backbone biosynthesis
bcz01100  Metabolic pathways
bcz01110  Biosynthesis of secondary metabolites
bcz01120  Microbial metabolism in diverse environments
bcz01130  Biosynthesis of antibiotics
bcz01200  Carbon metabolism
bcz01212  Fatty acid metabolism
bcz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCE33L3329 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BCE33L3329 (mmgA)
   00640 Propanoate metabolism
    BCE33L3329 (mmgA)
   00650 Butanoate metabolism
    BCE33L3329 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCE33L3329 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BCE33L3329 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCE33L3329 (mmgA)
   00310 Lysine degradation
    BCE33L3329 (mmgA)
   00380 Tryptophan metabolism
    BCE33L3329 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCE33L3329 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCE33L3329 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCE33L3329 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcz04147]
    BCE33L3329 (mmgA)
Enzymes [BR:bcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCE33L3329 (mmgA)
Exosome [BR:bcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCE33L3329 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAU16934
UniProt: Q637K3
Position
complement(3462270..3463361)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGMERAIDDVILGNVVGPGGNV
ARLSALEAGLSHHIPGVTIDRQCGAGLEAIRTACHFIQGGAGKCYIAGGVESTSMSPFQN
RARFSPETIGDPNMGVAAEYVAESYNITREMQDEYACLSYKRTLQALAKGYIHEEILSFN
GLLDESIKPEMNYERIIKRTKPAFLHNGTVTAGNSCGVNDGACTVLVMEEGQARKLGYKP
VLRFVRSVVVGVDPNLPGTGPIFALNKLLDEMNMKVEDIDYFEINEAFASKVVACAKELQ
IPYEKLNVNGGAIALGHPYGASGAMLITRLFYQAKRERMKYGIATLGIGGGIGLALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaagcgaaaaggacacctattggtaagaagaatgggatg
ttaaaagactatgaagttcagcaattagcagcaccgcttcttacatttttaagtaaagga
atggagagagcgatagacgatgtcatattagggaatgttgttgggccaggagggaatgtt
gcgagattatctgctttagaagcagggcttagtcatcatattccgggtgtaacgattgac
cggcaatgtggtgccggattggaagcgattcgcaccgcgtgtcatttcattcaaggcggg
gccggtaagtgttatatcgccggaggagtagagagtacaagtatgtcaccttttcaaaat
agagcacgattttcaccagaaacaataggcgatcctaatatgggagtagcggctgaatat
gttgcagaaagttataacatcacgagagaaatgcaagacgagtatgcatgcctcagttat
aaacgaacactgcaagcattagcaaaaggatatatacatgaggaaatattgtcttttaat
ggattgctagatgaatccattaagccagaaatgaattatgaacgaatcattaaaagaaca
aaacctgcatttttacacaatggtacagtaacggcaggtaattcgtgcggtgtaaatgat
ggagcatgtaccgttcttgtaatggaagagggacaagcccgaaaattaggatacaagcct
gtacttcgtttcgttcgtagtgttgtagttggagtggatcccaaccttccggggactggt
ccgatatttgcgttgaacaaattattagacgaaatgaatatgaaagtagaggacatcgat
tattttgaaataaacgaagcgttcgcttcaaaagttgtagcttgtgcaaaggaattacaa
attccgtatgaaaaattaaatgtaaatggtggtgcaattgcgctcggtcatccgtacggt
gcatctggggctatgcttataacgcgcttgttttatcaggcgaaacgagagcgtatgaaa
tacggaatcgcgacgttaggaatagggggcgggataggtcttgcactattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system