KEGG   Bacillus cereus E33L: BCE33L3595Help
Entry
BCE33L3595        CDS       T00198                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00020  Citrate cycle (TCA cycle)
bcz00640  Propanoate metabolism
bcz00660  C5-Branched dibasic acid metabolism
bcz01100  Metabolic pathways
bcz01110  Biosynthesis of secondary metabolites
bcz01120  Microbial metabolism in diverse environments
bcz01130  Biosynthesis of antibiotics
bcz01200  Carbon metabolism
Module
bcz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCE33L3595 (sucC)
   00640 Propanoate metabolism
    BCE33L3595 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BCE33L3595 (sucC)
Enzymes [BR:bcz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BCE33L3595 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AAU16671
UniProt: Q636J0
Position
complement(3732960..3734120)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDILELRDLDEEDA
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagcagcgaaagaattaggaacg
gatgtatgtgtagtaaaagcacaaattcacgctggtggacgcggcaaagctggcggagta
aaagttgcaaaaaatttagatgaagttcgtacatatgcagagagcattttaggaactaca
cttgtgacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtcttgttttagatcgtgcaacttctcaa
gttgttttaatggcgtctgaagaaggcggaacagaaattgaagaagtagcagaaaaaaca
ccagaaaagatctttaaagaatatattgatccagcagtaggtttacaaggcttccaagca
cgccgaattgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttataccgtgcgtttatcgaaaaagattgttctatcgcagagattaatcca
cttgttacaacaggtgacggtaaagttatggcattagatgcgaaattaaactttgattct
aacgctttatatcgccataaagacattttagaacttcgtgaccttgatgaagaagatgca
aaagaaatcgaagcttctaaatatgacttaaactacattcctttagatggaaatatcggt
tgtatggttaatggtgcaggtttagcgatggctacgatggatatcattaaacattaccat
ggagatccagctaacttcttagatgttggtggcggtgcgacagctgaaaaagttacagaa
gcgtttaaaattatcctttctgacaaaaatgtaaaaggtatcttcgttaacatttttggt
ggcattatgaagtgtgatgttattgcagaaggtgttattgaagcaacgaaacaagtaggt
cttgaattgcctttagttgtacgtcttgaaggtacaaacgttgagttaggtaagaaaatt
ttaaatgagtctggcttaaatattgttgcagcagaatctatggcagacggtgcacaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system