KEGG   Bacillus cereus E33L: BCE33L3671Help
Entry
BCE33L3671        CDS       T00198                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00471  D-Glutamine and D-glutamate metabolism
bcz00550  Peptidoglycan biosynthesis
bcz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BCE33L3671 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCE33L3671 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcz01011]
    BCE33L3671 (murD)
Enzymes [BR:bcz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BCE33L3671 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:bcz01011]
 Precursor biosynthesis
  Amino acid ligase
   BCE33L3671 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C 2-Hacid_dh_C Mur_ligase DUF1188 SsgA PTS_IIB
Motif
Other DBs
NCBI-ProteinID: AAU16595
UniProt: Q636B4
Position
complement(3811060..3812412)
Genome map
AA seq 450 aa AA seqDB search
MKTVTEFQNKNILVLGIAKSGYAAATLLQKLGANVIVNDGKPLAENVLAAELQAKGMDVV
CGGHPLELLERNISLVVKNPGIPYSNPILVAAKEKQIPIVTEVELAYRISEAPFVGITGS
NGKTTTTMLTFEMLKEGQKHPVIAGNIGTVACEVAQDAKENEVVVTELSSFQLMGVELFQ
PKIAAFLNLFEAHLDYHGTKKEYGLAKANIFKNQTENDYSVINADDADVMALSAYSKGQK
VLFSTTKEIEDGACIKDNALYFKAEKVVEVDDIVLPGQHNLENILAAMSIAKLLGVSNEA
ITAVLKRFTGVKHRLEYVTTINNRKFYNDSKATNMLATEKALSAFTQPTVLLAGGLDRGN
EFDDLIPYFKNVKAIVTFGQTAPKLVRAAEKAGLDTIESVDTLDEAVVKAYAHSTDGDVI
LLSPACASWDQFKTFEERGDIFIQAVHKLI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaactgtaactgaatttcaaaataaaaatattcttgtattaggcattgcaaaaagt
ggttatgcagcagctacgctgttacaaaagttaggggcaaatgttattgtaaatgacgga
aagccgttagcagaaaatgtactcgctgcagaattacaagcaaaaggaatggacgttgta
tgcggtggtcatcctttagagctattagagagaaatatttctcttgtagtaaaaaatcca
ggaatcccgtattctaatccaatattagttgctgcgaaagaaaagcaaattccaattgtt
acagaagttgaattagcatatcgtatttcagaagcaccatttgttgggattacgggatct
aacggtaaaacgacgacgacaatgcttacatttgaaatgctaaaagaaggacagaagcat
cctgtaattgcagggaacattggaactgtagcgtgtgaagttgcacaggatgcaaaagaa
aatgaagttgtagttacagaactttcatcgttccaattgatgggagtagaattgttccaa
cctaaaattgctgcgtttttaaatttatttgaggcccacttagattatcatgggacgaag
aaagaatatggtttagcaaaagcaaatatttttaaaaaccaaacagaaaatgattatagt
gtaataaatgcagatgatgcagatgtgatggctttatctgcttatagtaaaggtcaaaaa
gtactattctcaacaacgaaagaaattgaagatggtgcgtgtataaaagataatgctctt
tattttaaagctgaaaaagttgttgaagtagacgatatcgttttaccaggtcaacataat
ttagaaaatattttagcagcgatgagtatcgcaaaattattgggtgtttctaacgaagcg
attacggcggtgttaaaacgttttacaggtgtaaaacatcgtttagaatatgtaacaact
ataaacaaccgtaagttttataatgactcaaaagcaacgaatatgttagcgacagagaaa
gctttatctgcgtttacacaaccgactgtgttattagcaggtgggcttgatcgtgggaat
gagttcgatgatttaattccgtatttcaaaaatgttaaagcgattgtaacatttggacaa
accgctccaaaattagtaagagccgcagaaaaagcgggactagatacaattgaaagtgtc
gatactttagatgaagcggtagtgaaagcttatgctcattctacagatggcgatgtaatt
cttctctctccagcatgtgcaagctgggatcaatttaaaacatttgaagaaagaggagac
atttttatacaagctgtgcataaacttatataa

DBGET integrated database retrieval system