KEGG   Bacillus cereus E33L: BCE33L3780Help
Entry
BCE33L3780        CDS       T00198                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase, acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00071  Fatty acid degradation
bcz00072  Synthesis and degradation of ketone bodies
bcz00280  Valine, leucine and isoleucine degradation
bcz00310  Lysine degradation
bcz00362  Benzoate degradation
bcz00380  Tryptophan metabolism
bcz00620  Pyruvate metabolism
bcz00630  Glyoxylate and dicarboxylate metabolism
bcz00640  Propanoate metabolism
bcz00650  Butanoate metabolism
bcz00900  Terpenoid backbone biosynthesis
bcz01100  Metabolic pathways
bcz01110  Biosynthesis of secondary metabolites
bcz01120  Microbial metabolism in diverse environments
bcz01130  Biosynthesis of antibiotics
bcz01200  Carbon metabolism
bcz01212  Fatty acid metabolism
bcz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCE33L3780 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    BCE33L3780 (thl)
   00640 Propanoate metabolism
    BCE33L3780 (thl)
   00650 Butanoate metabolism
    BCE33L3780 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCE33L3780 (thl)
   00072 Synthesis and degradation of ketone bodies
    BCE33L3780 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCE33L3780 (thl)
   00310 Lysine degradation
    BCE33L3780 (thl)
   00380 Tryptophan metabolism
    BCE33L3780 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCE33L3780 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCE33L3780 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCE33L3780 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcz04147]
    BCE33L3780 (thl)
Enzymes [BR:bcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCE33L3780 (thl)
Exosome [BR:bcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCE33L3780 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAU16487
UniProt: Q635Q6
Position
complement(3917775..3918950)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKGGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLFEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagctgcagggtttcctgacacagttaca
ggttatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgtcgttgcaggtggagtagaagcaatgagttca
agcccttatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtattagaagatccaattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcattgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagcaggattaaaaccagctttccgtaaaggcggatctgta
acggcagggaatgcatctggtctgaatgacggaagtgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatggggattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttatttgaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagaccgtgagaaagtgaatgtaaacggt
agtggtgtaggacttggacatccaatcggttgtacaggagctcgtatcactgtaagttta
attcatgaattgaaaagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggggtagcattatttatagaagcactataa

DBGET integrated database retrieval system