KEGG   Bacillus cereus E33L: BCE33L4236
Entry
BCE33L4236        CDS       T00198                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00471  D-Glutamine and D-glutamate metabolism
bcz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BCE33L4236 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcz01011]
    BCE33L4236 (murI)
Enzymes [BR:bcz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BCE33L4236 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:bcz01011]
 Precursor biosynthesis
  Racemase
   BCE33L4236 (murI)
SSDB
Motif
Pfam: Asp_Glu_race Flu_M1
Other DBs
NCBI-ProteinID: AAU16033
UniProt: Q633V2
Position
complement(4346850..4347659)
AA seq 269 aa
MKLNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTERCPYGPRSREEVRQFTWEMTE
HLLDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKMTNTYHVGIIGTIG
TVKSGAYEEALKSINNRVVVESLACPPFVELVESGNFESEMAYEVVRETLQPLKNTDIDT
LILGCTHYPILGPVIKQVMGDKVQLISSGDETAREVSTILYHSKMLNEGEEQSDHLFLTT
GKIGLFKEIASKWFGQPIENVKHIHLEKE
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaagttgaatagagcaatcggtgttatcgattcaggagttggcggcttaacagtagcg
aaggaattaattcgtcagttgccgaaagagcgcattatatatttaggggatacagaacgt
tgcccttatggtccacgttctcgagaagaagtgcgccaattcacgtgggaaatgacggag
catttactagatttaaatatcaaaatgttagttattgcatgcaatacagcaactgcagtt
gtattagaagagatgcagaaacaattaccaattccagtggtaggagttattcacccagga
tcacgtacagctttaaaaatgacaaacacgtatcatgttgggattattggaacgatcgga
acggtgaaaagtggtgcatatgaagaggcgttaaagtctattaataaccgtgttgtggta
gaaagtttagcgtgtccgcctttcgttgagcttgtagagagtggcaattttgaaagtgaa
atggcatatgaagttgtaagagaaacgttgcaacctctgaaaaacactgatattgatacg
cttattttaggttgtacacattatccgattttaggccctgttattaaacaagtaatggga
gataaagtgcaactcattagttctggtgatgaaacagcgcgtgaagtaagtacaatttta
taccatagtaaaatgttgaatgagggagaggaacaaagcgaccatctcttcttaacaaca
gggaaaataggcttatttaaagaaattgcatcaaaatggttcggtcaaccaattgaaaat
gtgaaacatattcatttagaaaaagaataa

DBGET integrated database retrieval system