KEGG   Bacillus cereus E33L: BCE33L4609Help
Entry
BCE33L4609        CDS       T00198                                 

Definition
(GenBank) hydrolase; menaquinone biosynthesis related protein; possible prolyl aminopeptidase
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00130  Ubiquinone and other terpenoid-quinone biosynthesis
bcz01100  Metabolic pathways
bcz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BCE33L4609
Enzymes [BR:bcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     BCE33L4609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Thioesterase PGAP1 DUF676 BAAT_C
Motif
Other DBs
NCBI-ProteinID: AAU15665
UniProt: Q632I3
Position
complement(4697342..4698154)
Genome map
AA seq 270 aa AA seqDB search
MNVTLQGVSYEYEVVGSGEPLLLLHGFTGSMETWRSFVPSWSEQFQVILVDIVGHGKTES
PEDVTHYDIRNAALQMKELLDFLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCT
AGLESEDEREERREKDERLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERL
ANNSKGLANSLRSMGTGAQPSWWNELQNLKMPVLLMNGEYDEKFFRILKNIEKCVSDAKF
VKIDGAGHAIHVEQPEKFDTIVKGFLKTMQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaacgctgcaaggtgtatcgtatgaatatgaagtagtcggaagcggagagcca
cttctacttcttcatggttttacgggaagcatggaaacgtggcgttcattcgttccttct
tggagcgagcaatttcaagttattttagtagacattgttgggcacggaaaaacagaaagc
cctgaagatgtgacgcattatgatattcgaaatgcagcattgcaaatgaaagaactacta
gatttccttcatattgaaaaagcgcacatactcggctattcaatgggcggtagactggcg
attacgatggcatgtctatatccagaatatgtacgttctcttttattagaaaattgtaca
gctggtcttgaaagtgaagatgagcgggaagaacgtcgtgaaaaagacgagcgacttgcc
gataaaatcgagcgagaaggcatcgaaagttttgtaacaatgtgggaaaatattccgctg
tttgaaacgcaaaaaagtttagcacaaaacgtacaagaagcagtgcgaaaagaacgactt
gctaacaattcaaaaggacttgcaaatagcttgcgtagcatgggaacaggggctcagcct
tcatggtggaatgagctgcaaaacttaaagatgcctgttcttttaatgaacggagagtat
gatgaaaagttctttcgcatattaaaaaatatcgaaaaatgcgtctctgacgcgaaattt
gtcaaaattgatggtgctggccatgcaattcatgtggaacaaccggaaaagtttgataca
atagtaaagggatttctaaaaactatgcagtga

DBGET integrated database retrieval system