KEGG   Bacillus cereus E33L: pE33L466_0357Help
Entry
pE33L466_0357     CDS       T00198                                 

Definition
(GenBank) probable zinc-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    pE33L466_0357
Enzymes [BR:bcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     pE33L466_0357
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     pE33L466_0357
    1.1.1.-  
     pE33L466_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AMIN Pyr_redox_3 UDPG_MGDP_dh_N ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AAY60500
UniProt: Q4V1A7
Position
pE33L466:356765..357814
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGQKDIRIEDKELKPLKDNEVTVRVAWAGICGSDLHEYQEGPVFVPVDAPDELT
GEVAPIIMGHEFAGVVEKVGSAVKKYKVGDRVVVNPTITHGNKPEDIDCYDGFSFIGLHG
DGGFTTFANAPEHNIYKLPDTLTLQDGALVEPTAVAVQAVKEGGMQFGDTVAIFGAGPIG
LLTTIAAKAAGASKILVFDLSETRLEKAKELGATEVFNSGKINPVEAVKQHAPNGVDVTF
EVAGVAPTFKSAIDVTRPRGTVVIVSIFAHSIEWNPMQLTNTGVKVTSTIAYTPTSFQQT
VDLMGTGQLKPQGIVTSQIELENIVEKGFEALTSDKSQAKILVKLSGEM
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtacggacaaaaagatattcgcattgaggataaagaattaaaa
ccattaaaagataatgaagtgacagttcgtgtagcatgggcaggtatttgtggatctgat
ttacatgaatatcaagaaggaccggttttcgtacctgtagatgctccagatgagttaact
ggggaagtagctccaatcattatgggacatgaatttgcaggtgtagtagaaaaagttggt
tcagcagtaaaaaaatataaagttggtgatcgtgtagttgtcaatcctacaattacacat
ggtaacaaaccagaagacattgattgctatgatggttttagttttatcggtttacacggt
gatggtggatttacaacctttgccaatgctcctgaacataatatttataaattacctgat
actttaactttacaagatggtgcattagtagagccaactgctgtagcggttcaagcagtt
aaagaaggtggtatgcaatttggtgatactgtagctatctttggtgcaggtccaatcggt
ttattaacgacaattgcggcaaaagcagcaggtgcaagtaagattcttgtatttgaccta
tctgaaacacgtcttgaaaaggcaaaagaactgggcgcaactgaagtgtttaactctggg
aaaataaatcctgttgaagcagtaaaacagcatgcccctaatggtgtggatgttacattt
gaagtagcgggtgttgcaccaacttttaaatctgctatcgatgttacaagacctcgtggt
acagttgttatcgtatcaatttttgctcattcaatcgaatggaatccaatgcaattgact
aacacaggtgttaaagttacttctactattgcttatacaccaacttctttccagcaaact
gttgatttaatgggaacaggacaattaaaacctcaaggtattgtaacgtctcaaattgaa
ttggaaaatatcgtagaaaaagggtttgaagcattaacaagtgataaatcacaagcgaaa
attttagtgaagttaagtggagaaatgtaa

DBGET integrated database retrieval system