KEGG   Bifidobacterium dentium Bd1: BDP_0124Help
Entry
BDP_0124          CDS       T01143                                 

Definition
(GenBank) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00460  Cyanoamino acid metabolism
bde00500  Starch and sucrose metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BDP_0124
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BDP_0124
Enzymes [BR:bde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BDP_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ADB08809
UniProt: D2Q763
Position
148206..149573
Genome map
AA seq 455 aa AA seqDB search
MENTFPKDFVFGTATAAYQIEGAVNEDGRCPSIWDTFSHTPGATFAGDTGDVATDSYHRW
REDLALLNDLGVDAYRFSIAMPRIMPTPNGIPNAKGLDFYERIVDTLLEYGIKPVVTLYH
WDLPQYLEDAGGWLNRVTSYALGDYAAVVAKRLGDRVDTWTTLNEPWCASYLSYGAKEQA
PGLGLGPGAFPAVNHLNLAHGLMVQAVRDIVGDKSKYSVTLNMPFNRGDADACHRLDLIA
NRAFLDPMLRGRYPDELFAITKGICDWSFIQPGDLENAHQPIDVLGVNYYSTNRVAMSDR
PQFPQETGPSTCPGASDIDWLPTDGPHTDMGWNIDPQGLYDTLMRVHDRYPEVDLVITEN
GMACRDQLVVNEDGTKAVHDADRIDYLERHFAAAKRALDDGVPLSGYFVWSLLDNFEWYF
GYAKRFGITYVDYATQERTKKDSFLWYRDFIASRG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggagaacacattcccgaaggatttcgtttttggcacggctacggcagcctatcagatc
gaaggcgcggtgaacgaggacggtcgctgcccctcgatctgggatactttcagccatact
ccgggagccaccttcgcaggcgataccggcgacgtagccacggattcataccatcgttgg
cgggaggatctggcgctgctcaacgatttgggcgtggatgcctaccgtttctcgatcgcc
atgccgcgcatcatgcccacgccgaacggcatcccgaatgcgaagggtctcgacttctac
gagcgcatcgtcgataccctgctcgagtacggcatcaagccggtcgtgacgctctaccac
tgggatttgccgcagtatctggaggatgcgggcggctggctcaatcgtgtgacctcctat
gcgttgggcgactatgcggccgtcgtcgccaaacggcttggcgaccgcgtcgacacatgg
accacgctgaacgaaccgtggtgcgcctcatatctgagctatggtgcgaaggagcaggct
ccggggctgggactcggtccgggcgcatttccggcggtgaatcatctgaatctcgcccac
ggcctgatggtgcaggcggtgcgcgacatcgtcggcgacaagtcgaagtattcggtcacg
ctgaacatgccgttcaatcgcggtgatgccgatgcctgccatcgtctcgacctgatcgcc
aatcgtgccttccttgatccgatgctgcgtggccgctaccctgacgaactgttcgccatc
accaagggcatctgtgactggagcttcatacagccgggtgacctggagaacgcgcaccag
ccgatcgatgtgctgggcgtcaactattactccaccaatcgtgtggccatgagcgaccgt
ccgcagttcccgcaggagaccggcccgtccacctgccccggcgcctccgacatcgattgg
ctgccgaccgacggtccgcacaccgacatgggatggaacatcgacccgcagggcctgtac
gacacgttgatgcgtgtgcatgaccgctatccggaggtcgatctggtcatcaccgaaaat
ggcatggcctgcagggaccagctggtcgtgaacgaggacggtaccaaggcggtgcatgac
gccgatcgcatcgattatcttgagcgacatttcgccgccgcgaagcgtgcattggacgat
ggcgtgccgctgagcggttatttcgtgtggtcgctgctcgacaatttcgagtggtatttc
ggctatgccaagcgattcggcatcacctacgtcgattacgccacccaggagcgcacgaag
aaggacagcttcctgtggtaccgagacttcatcgcctcgcgtggctga

DBGET integrated database retrieval system