KEGG   Bifidobacterium dentium Bd1: BDP_1172Help
Entry
BDP_1172          CDS       T01143                                 

Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00020  Citrate cycle (TCA cycle)
bde00640  Propanoate metabolism
bde00660  C5-Branched dibasic acid metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01120  Microbial metabolism in diverse environments
bde01130  Biosynthesis of antibiotics
bde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDP_1172
   00640 Propanoate metabolism
    BDP_1172
   00660 C5-Branched dibasic acid metabolism
    BDP_1172
Enzymes [BR:bde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BDP_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADB09800
UniProt: D2QAG4
Position
complement(1319312..1320505)
Genome map
AA seq 397 aa AA seqDB search
MDLYEYQARELLEEQGIATPKAVFAQNSHEVAQAAEGIGYPCVVKAQVKIGHRGQAGGVR
LAKTRDEAILASEDILPMTIHKHKVSGVLVAEAKNILHEYYVSISVDRSSRDFDVLATAN
GGTEVEEIAREHPESVKRLHIDALEDFDIEAATKMAESIGFYHADVDQAAQILLKMWRCF
KENDATLVEINPLAKIGDPDDESSKTLCALDAKISLDDNAAFRHDGWKRFADPVHVDPFE
QKAREHGLHYVHLNGSVGVIGNGAGLVMSSLDAVSGASEDQGTNVKPANFLDIGGGASAQ
VMCDSLEIVLSDPQVESVLVNVYGGITSCEQVAEGILEALDKLGSSKPLVVRFDGNAAAE
GLSILARADRANLHVAQTMEEAAQQAAHLAANGREVR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggatctctatgaatatcaagcaagggaactgctcgaagagcagggcattgcgaccccg
aaggccgtattcgctcagaattctcatgaggtggcccaagctgccgagggaatcggctat
ccttgcgtggtcaaggcccaggtgaagatcggacatcgcggccaggctggtggcgtgaga
ctggccaagacgcgcgacgaagccattctggcatccgaagacattctgccgatgaccatt
cacaagcacaaggtcagcggcgtgctcgtggcggaagccaaaaacattctgcacgagtat
tatgtgtccatttccgtggaccgtagttcacgtgatttcgacgtccttgccacggcaaac
ggtggcaccgaggtcgaggaaatcgctcgggaacatcccgaatccgtcaagcgtctgcat
atcgacgccttggaggacttcgatatcgaagccgccaccaaaatggccgaaagcatcggt
ttctaccatgccgacgtcgatcaggcggcacagattctgctgaagatgtggcgttgcttc
aaggagaacgacgccacccttgtggaaatcaatccgctcgccaagatcggcgatcccgac
gatgaatcctcaaagacgttgtgcgcgctcgatgccaagatctcactcgacgacaatgcg
gccttccgccatgacggttggaagcgttttgccgatccggtgcatgtcgatccatttgag
cagaaggctcgtgagcatggtctgcactatgtgcatctcaatggatccgtcggtgtaatc
ggcaacggcgcaggcctggtcatgagttccttggacgcagtgtccggcgccagcgaggat
cagggcacgaatgtcaagcccgccaacttcctcgatatcggcggcggcgcatctgcgcag
gtcatgtgtgacagtctggaaatcgtattgtccgacccacaggttgaatccgtgctcgtc
aacgtatatggcggtatcacctcctgcgaacaggtggccgagggcattctcgaagcactt
gacaaactgggcagttccaagccgctcgtcgttcggtttgatggcaatgccgcggctgaa
ggcctgagcatcctggcacgggccgatcgcgccaatctgcatgtcgcccagaccatggaa
gaagccgcgcagcaggccgcacatcttgcggccaacggcagggaggttcgctga

DBGET integrated database retrieval system