KEGG   Bifidobacterium dentium Bd1: BDP_1223Help
Entry
BDP_1223          CDS       T01143                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00010  Glycolysis / Gluconeogenesis
bde00260  Glycine, serine and threonine metabolism
bde00680  Methane metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01120  Microbial metabolism in diverse environments
bde01130  Biosynthesis of antibiotics
bde01200  Carbon metabolism
bde01230  Biosynthesis of amino acids
Module
bde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDP_1223
  Energy metabolism
   00680 Methane metabolism
    BDP_1223
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDP_1223
Enzymes [BR:bde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BDP_1223
Membrane trafficking [BR:bde04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BDP_1223
Exosome [BR:bde04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BDP_1223
  Exosomal proteins of melanoma cells
   BDP_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADB09849
UniProt: D2QAL3
Position
complement(1370000..1370827)
Genome map
AA seq 275 aa AA seqDB search
MIDEVLFLRHGRTAYNLGRRLQGQIDIPLDIVGRWQVDQSAYELARRYYWAKITNQAQHP
ETLQQPTGPDAHLADPNEITQAPASKRQMTIISSDLFRAQQTARAFANLLGLPVEYDSRL
RERSFGEWEGMTREEIREANAPDYDSWRSHTGGELNHGVESRTHTGQRGSRAVLDILDRH
RENIVPTTLLIVGHGSWIVATIETLLGMDPDSLNNLGSMRNAFWSRMTPAGDAERPRWTL
DEFNQGPAIAAFTDWENGPDDLREPNMPQWKPIMQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgaagtactgttcctacgccacggaagaaccgcctacaaccttggcagaaga
ctgcaaggccaaatcgacatccccctcgacatcgtcggccgatggcaggtggaccaaagc
gcctacgaacttgcccgccgatactactgggcgaaaatcaccaatcaggcacagcatccc
gaaaccctgcaacaaccaaccggaccggacgcgcatctcgccgacccgaacgaaatcaca
caagcgccggcatcgaaacgccagatgaccatcatctcctccgacctgttccgcgcacaa
cagaccgcgcgcgccttcgccaacctgctcggcctgcccgtcgaatacgactccaggcta
cgcgaacgcagtttcggcgagtgggaaggcatgacccgtgaggaaatacgagaagccaac
gccccggactacgactcatggcgctcacataccggcggagaactcaaccatggcgtggaa
agccgcacccacaccggacaacgaggaagccgggcggtgctcgacattcttgaccgacac
cgcgaaaacatcgtgccgaccacactgcttatcgtcggccacggatcctggatcgtcgcc
accatcgaaacactgctcggcatggaccccgacagtctcaacaaccttggctccatgcgc
aacgccttctggtcacgcatgacgcctgccggcgatgcggaacgaccccgatggacactt
gacgaattcaaccaaggtccggccattgcagcattcaccgactgggagaacggacccgac
gacctcagagaaccgaacatgccgcaatggaaaccgatcatgcagtaa

DBGET integrated database retrieval system