KEGG   Bifidobacterium dentium Bd1: BDP_1750Help
Entry
BDP_1750          CDS       T01143                                 

Definition
(GenBank) Glutamate:g-aminobutyrate antiporter
  KO
K20265  glutamate:GABA antiporter
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bde00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BDP_1750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bde02000]
    BDP_1750
Transporters [BR:bde02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BDP_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease
Motif
Other DBs
NCBI-ProteinID: ADB10339
UniProt: D2Q5X4
Position
1982566..1983978
Genome map
AA seq 470 aa AA seqDB search
MSVGQLAMLTVVAVASLRSLPAMADYGLASILLYLIPAVFFLVPAALVAAELATGWKGGV
YVWVREAFGNRFGFLAIWLQWIQNVVWYPIQIAFIAVSLSYVFGAGNLGNNGVYIAAVII
VLYWISTVVALRGGNLFAKVGSISGLIGTLFPALLLIVFGAIWLGIGEPMHTSMHASALL
PPWTGIASIVLIVSNVLAYAGMEVNAVHANDMKNPGHQFPRAIALATALILLVFILPTLA
IAFAVPHRELGLIDGINLAFKEFFDHFGMSWGTPIISLLIAFGAFASVVTWIAGPSRGLL
AAARTGLMPPMLQKRNAHGVQEGILIPQGVIVTVLALLFVLIPNGNTAFATLVDMATALY
LVMYMLMFASAIRLRKIHPEVRRTYRVPAIRLIAGVGFIASAAAFVLTFVRPAGFTGLST
TAYAILVAVVVVVLGMPPLILYAMRKSNWDMRSDAEKNADAKGMLVNPEG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcggtcagctggccatgctgaccgtggtggcagtggcctctctacgttctttg
ccggccatggccgattatggtctggcatccatactgctgtatctgattccggccgtgttc
ttcctggtgccggccgcactggtcgccgccgaactggctaccggatggaaaggcggtgtg
tatgtgtgggtgcgcgaggcgttcggtaaccgtttcggctttcttgccatctggctgcag
tggattcagaacgtggtgtggtatccaattcagatcgccttcatcgcggtgagcctttcg
tatgtgttcggtgccggcaatctgggcaataacggcgtgtacattgccgcagtgatcatc
gtgctgtattggatcagcacggtggtggctttgcgtggcggcaatctcttcgccaaggtc
ggctcgatctccggactgatcggtaccctgttccccgcgctgctgctgatcgtgttcggc
gcgatctggctgggcatcggcgagccgatgcacacttccatgcacgcctccgctttgctg
ccgccgtggaccggcatcgcatcgatcgtgctcatcgtctccaacgtgctggcttatgcg
ggcatggaagtcaacgccgtgcatgccaatgacatgaagaatccgggccatcagttcccg
cgcgccatcgcactggccaccgcgttgattctgctcgtgttcattctgccgactctggcc
atcgccttcgccgtgccgcatcgtgagctcggtctgatcgatggcatcaatctggcgttc
aaggagttcttcgaccacttcggcatgagctggggcaccccgatcatttcgctgctgatc
gcattcggcgcgttcgcttccgtcgtgacatggatcgcaggaccctctcgcggccttctg
gccgccgcccgcaccggtttgatgccgccgatgctgcagaagcgcaacgcccacggtgtt
caggaaggcattctgattccgcagggtgtgatcgtgaccgtgctggcgttgctgttcgtg
ctgattccgaatggtaataccgccttcgcgacactggtcgatatggccaccgcactgtat
ctggtgatgtacatgctgatgttcgcctccgcgattcggctgcgcaagatccatcccgaa
gtcaggcgcacgtaccgtgtgccggctattcgtctgattgcgggcgtcggcttcatcgcc
tccgccgcggccttcgtgctgacgttcgtgcgtccggccggatttaccggtctgagcacc
acggcctacgcgattctggtggccgtggttgtggtggtgcttggcatgccgccgctgatt
ctgtatgcgatgcgcaagtcgaattgggatatgcgttcggacgcggagaagaacgcggac
gcaaaaggaatgctggtgaatccggaaggatag

DBGET integrated database retrieval system