KEGG   Bifidobacterium dentium Bd1: BDP_1756Help
Entry
BDP_1756          CDS       T01143                                 

Gene name
dapA
Definition
(GenBank) DapA dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00261  Monobactam biosynthesis
bde00300  Lysine biosynthesis
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01120  Microbial metabolism in diverse environments
bde01130  Biosynthesis of antibiotics
bde01230  Biosynthesis of amino acids
Module
bde_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BDP_1756 (dapA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BDP_1756 (dapA)
Enzymes [BR:bde01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     BDP_1756 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS NMO Dus Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADB10344
UniProt: D2Q5X9
Position
complement(1991181..1992086)
Genome map
AA seq 301 aa AA seqDB search
MTDGTMHLLDPAPFGRILPAMVTPMKADGSVDFEAARKLATQLVADGADGLVVNGTTGES
PTTHMEEKVELVQAVKDVVDVPVISGAGSNDTAHTVRMVEQTQEAGADAVLVVAPYYSRP
SQEGVFRHYKAVNDSADKPIIVYDVPGRTGLHIQLETYRRLAELDHVKAVKDATGDIAGA
VRKRMETGLTWYSGDDGLFLPFLSVGAVGIISVIAHAAAGPMRDLANAFDRGDIHEAQRL
AVQLAPLVESMNGNGFQAVMAKASLKVRGILDDTTMRLPNVGPGEAEIKRAEAGMRASGL
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgactgacggtacgatgcatcttctcgatcccgctcctttcgggcgaattctcccggcc
atggtgacccccatgaaggccgatggctccgttgatttcgaggccgcgcgcaagcttgcg
acgcagctcgtggccgacggtgccgatggtcttgtggtcaacggcaccaccggcgaatca
ccgaccactcacatggaggagaaggtcgagctggttcaggccgtcaaggacgtcgtggac
gtgccggtcatctccggtgccggctccaacgacaccgcacacaccgtgcgcatggtggag
cagacgcaggaggcgggcgccgatgcggtgctcgtggtcgcgccatactactcccgtcct
tctcaggagggtgtgttccgtcattacaaggcggtcaacgattcggcggacaagccgatt
atcgtctacgatgtgccaggccgcaccggtctgcacatccagctggaaacctaccgtcga
ctggccgaactcgaccatgtcaaggcggtgaaggacgccaccggcgacatcgcgggagcc
gtgcgcaagcgtatggaaaccggcctgacctggtattccggcgatgatggcctgttcctg
ccgttcctttccgtaggtgcggtcggcatcatctccgtgatcgcgcacgcggcggccggc
ccgatgcgtgacctcgccaacgccttcgaccgtggtgacatccacgaggcgcagcgtctt
gccgtgcaactcgcgccgctggtcgaatccatgaacggcaacggcttccaggccgtcatg
gccaaggcctccctgaaggtacgcggcattcttgacgacaccaccatgcgtctgccgaat
gtcggtccgggtgaggctgaaatcaaacgtgccgaggcaggcatgcgcgcctccggtctg
ctgtaa

DBGET integrated database retrieval system