KEGG   Bifidobacterium dentium Bd1: BDP_1760Help
Entry
BDP_1760          CDS       T01143                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K21600  CsoR family transcriptional regulator, copper-sensing transcriptional repressor
Organism
bde  Bifidobacterium dentium Bd1
Brite
KEGG Orthology (KO) [BR:bde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bde03000]
    BDP_1760
Transcription factors [BR:bde03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BDP_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trns_repr_metal Big_3_4
Motif
Other DBs
NCBI-ProteinID: ADB10348
UniProt: D2Q5Y3
Position
1996866..1997159
Genome map
AA seq 97 aa AA seqDB search
MNVTQHGYADDQKNIIARLNRIEGQVRGIKQMTEDGEYCIDILTQISAANSALKSVALLL
LDDHLNHCVKQATQEGGAVSDEKLTEVSAAITRLVKS
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttacgcaacacggctatgcggatgaccagaagaacatcatcgcccgcctcaat
cgcatcgaaggtcaggtgcgcggcatcaaacaaatgacggaggacggcgagtactgcatt
gacatcctcacccagatctccgccgccaacagtgcattgaaatcagtggcactgctgctg
ctcgacgaccatctcaatcattgcgtcaagcaggccacgcaggaaggcggcgccgtttcc
gacgaaaagctcaccgaagtcagcgcggccatcaccagattggtcaaatcgtga

DBGET integrated database retrieval system