KEGG   Bifidobacterium dentium Bd1: BDP_1761Help
Entry
BDP_1761          CDS       T01143                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADB10349
UniProt: D2Q5Y4
Position
complement(1997373..1998380)
Genome map
AA seq 335 aa AA seqDB search
MKADSGYSRFMKNHARVNRLIEEAMAERRCAFSPIESENAALRRRIAEDGGLLRPARGLY
VPSDYWNGLDPFERSMHMARAMARQHPKWVFVGNIAATAHGFEHSWKLHDGTVSIASAYH
NGFCRIAKVRRVYIPEQCMSVEVVDGLPVLDKIRTVLNCSVQYDFPYGLPIADSALRQGI
GRRDLSAGCSAMRIGYAQAARVLRYADGASENGGESMCRAVMIDEGFAIPLLQTIFVDPE
TGRRYRADFAWRLPDGRIAVGEYDGTQKYVDPQMTGRRSVQTVVQMEREREEALRRAGVS
LIVRFTYDDVIERVPLVNKLLRAGLPRSSSSIHRR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccgattccggttacagtcgattcatgaagaatcatgcacgagttaatcgtctc
atcgaagaggctatggcggagcgacgatgcgcgttttcgcctattgagtcagagaatgcc
gccttacgcaggcggatcgctgaagacggagggctgttgcgtcccgcccgcggcctgtat
gttccctccgactattggaacggccttgatccgttcgaacgttccatgcacatggcgcgg
gcgatggcaaggcaacacccgaagtgggtgttcgttggaaacatcgccgcgacggctcat
ggtttcgaacattcctggaaactgcacgacggcaccgtttccatcgcgagcgcctatcac
aacggcttctgcagaatcgcgaaggttcgccgtgtgtatattccggagcaatgcatgtca
gtggaggtggttgacgggctgcctgttcttgacaaaatacgtacagtgctgaattgctcg
gtgcaatacgattttccatatgggcttcccattgcggattccgcgctgagacaaggaatc
ggacgtcgcgatttgtccgccggctgttcggctatgcgcatcggctatgcgcaggcggcg
cgcgtactgcgatatgccgatggtgcgagcgagaacggcggcgaatcgatgtgccgtgca
gtgatgattgatgagggttttgccattccgctattgcagacgattttcgtcgatcccgaa
acagggcgtcgataccgtgccgattttgcatggcgactgccggacggtcggattgccgta
ggcgagtatgacggtacgcagaagtatgtcgatccgcagatgacaggccgtaggagcgtc
caaaccgtggtgcagatggagcgtgaacgtgaggaagcgttgcgtcgcgccggagtctcg
ctgatagtacggttcacctatgacgatgtgattgagcgagtgccgcttgtgaacaagctg
ctgcgggcgggccttccccgatcctcttcctcaatccaccgacggtga

DBGET integrated database retrieval system