KEGG   Bifidobacterium dentium Bd1: BDP_1768Help
Entry
BDP_1768          CDS       T01143                                 

Definition
(GenBank) ATP-dependent DNA helicase, UvrD/REP family
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDDEXK_1 UvrD_C AAA_19 UvrD-helicase DUF2800 DnaB_C Dna2
Motif
Other DBs
NCBI-ProteinID: ADB10355
UniProt: D2Q5Z0
Position
complement(2006044..2010105)
Genome map
AA seq 1353 aa AA seqDB search
MDLDDLADVTLVAGAPRSGKTEFALRALIAAMRRYGDTQAVMTVSGRQIADDLGDRVIRE
LSAISQARPVTTLPAVAFRIVTAVRSRAGLPLPKLLNGAEQDMIIRRVLASHVDHTNRGD
ECAVCDLLRTYFAVADWSGMVVDDSTDAFANQLRDMLARMNEIGAKPELEDGLIARAASK
DGTLNERHERMRTQWRLAFALRAEYDEAIRAAYPGEYRLDASQLMVDAAATVTQAEIEDL
PKLLIVDDFQDATLAGFDMLAALRGRGVRLLLVGNPDESVQTFRGSYPEYLFNAAQSRLG
ARLERIDVTETEQRKPAYRTLAASRVSLSIASTEPTDEALPSRPGKMPALPGSLPIETVP
TGVSVDGISPDDGSIGTAMYRSAVEELDDVVWRIKTEHLQHSRDWNDMAVIAHDNDTVRT
FGERLRADGVPVRYSSVTRPLKDEPFVQGLFALIELAGLKKQTIAASKMGLRTAGAYIRS
RVALIMNSPLITVGGDAQHEGRPTRLATVESAMNALGSLAAVLESDDSGELDDSDRADVA
KQALLPRLIADWKDYVVDLRNSRQLTRMSDSADSATPTIAVDDSLMSEERLDSADLVDPS
DLPFGVDALYVLLLEGNTDRVLDAIASVLGADPQSKAFASLWKVLDKTIEAERKLISREP
QYVLDCAWTACDKARIWQRVSLENSAAGRAANDRLDAAMRLFSYASGDESGGVLAAHTIG
AFIEQVRALTIEADSLAHTAPIDQAVTLTTPAGAAGRHWNLVFLPALQQGQWPNLAPRNT
LFGGESLADVMLHGELRDDIVTSAGRQDAQLAAVLASEQKSFLVALTRADERAVLSAVLN
DDNVPSDFLYGYLPERFDRERDADPEQRDYALVGGTGEFNGLDADPRGLVAAARSVLADE
PAGSSKAKDAAAALALLASRGIAAADPAYWPFAKQSETDDSESRDSHRSDVVTLSPSAVD
RLWACPVCWMLENRFAGPRMGSVATNFGSLIHKVAQKATEAGLDLPQNHTALNDEENIEN
ITQWMMAEYERLRGDLNAIPDPKERYEALGKDERAVDALRNIATYFVNSNRSGYPAKNAD
KFEVGKLTEAEPELQFAARFGFDDVLEAYNAIEGVDPIGRGELISLMGLLVGGWPETGMS
EWLTIRLSGRIDRLERRVLSGGGEQVRLIDYKTGKQLSGQDMFSDLQLACYQLGLAFPEE
GPRGAQAIALMPNIGQSALFHVMCSTAPAPRGTQGEEAYHQQALFANGSLNAGKYVPRFC
LPTFDKLFVDDLDGAERPEAVSDEHWRQFLELRSTMAVWSLTMIARVFYAAAACRAIRIT
ARPTSKHVKSCRNKSVCPACAGEQNTVFERRVA
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atggatttggatgaccttgcggatgtgacgttggtcgcgggagcgccccgcagcggcaaa
accgaatttgcgttacgtgcgctgatcgccgcgatgaggcggtatggcgatacgcaggcc
gtgatgacggtatcgggccggcagatcgccgatgacttgggcgaccgggtgattcgtgag
ttgtccgcgatttcgcaggcccgaccggtcaccacattgccggctgtggccttccgcatc
gtgacggccgtgcgctcgcgtgcgggtctgcctttgccgaagctgctcaacggcgccgaa
caggacatgatcatccgtcgcgtgctcgcctcgcatgtggaccatacgaatcgtggtgac
gaatgtgccgtctgcgacctgctgcgcacgtatttcgcggtggccgactggtcgggcatg
gtggtcgacgattccaccgacgcctttgccaaccagttgcgtgacatgctcgcccgcatg
aatgagatcggcgcaaaacccgaactcgaggatgggctgattgcacgtgccgccagtaag
gatggcacgctcaacgagcggcatgaacgcatgcgtacccaatggcgtctcgcctttgcg
ttgcgtgccgaatacgatgaggcgattcgcgcggcctatccgggcgaataccgtctcgac
gcatcgcagctcatggtcgatgcggccgccaccgtgacgcaggccgagatcgaagatctg
ccgaagttactgatcgtcgacgatttccaagatgccacgcttgccggattcgacatgctc
gcagctttgcgcgggcgcggcgtgcggctgctgctcgtcggcaatccggacgaatccgta
cagacgttccgcggatcgtatccggaatacctgttcaacgcggcgcaatcgcgattgggg
gctcggctggaacgcatcgacgtcacggaaacggaacaacgtaagcccgcgtatcgtacg
ctggccgcaagccgcgtgagtttgtcgatcgccagtaccgaaccgacggatgaggcgctg
ccgagtcgtccgggcaagatgccggcgctgccaggctcactacctatcgaaacggtgccg
acgggtgtctccgtagacggtatttcgccagatgacggcagcatcggaaccgccatgtac
cgctccgccgtcgaggagctggatgacgtggtctggaggatcaaaaccgagcatctgcaa
cattcccgcgactggaacgacatggctgtgatcgcgcacgacaacgacactgtgcgtacg
ttcggcgaacgactgcgggccgacggcgtgcctgtgcgctattcgagcgtgacccgcccg
ctgaaggacgagccattcgtgcagggcctgttcgcactgatcgaactggccggactgaag
aagcagacgattgcggcgtcgaagatggggcttcgtacggccggcgcgtatattcgttcg
cgcgtagcgctgatcatgaattcgccgctgatcacggtcggcggcgatgcacagcatgag
gggcgccccacacgattggcgaccgtcgaatcggcgatgaatgcgctcggctcgcttgcc
gcggtattggaatcggatgattccggtgaattggacgattcggacagggccgacgtagcg
aagcaggcgttgttgccgcgtttgattgccgattggaaggattacgtcgtcgatttgcgc
aactcacgtcagttgacacggatgtccgattcggcggattcggccacaccgacgattgcg
gtagacgacagtctgatgtcggaggaacggcttgattccgcggacttggtcgatccgtcc
gatcttccgtttggtgtggacgcgctgtatgtgctgctattggaaggcaatacggaccgc
gtgctcgacgcaatcgcctccgtactgggcgccgacccgcaatccaaagcatttgcgagc
ctgtggaaagtgctcgacaagaccatcgaagcggaacgtaagctcatctcccgtgaaccg
caatacgtgcttgattgcgcgtggactgcctgcgacaaggcacggatctggcagcgcgta
tcgttggaaaattccgcggcaggccgtgcggcgaacgaccgtttggacgcggcgatgcgc
ctgttcagctacgcatcgggcgacgaatcgggtggcgtgttggccgcacataccatcggc
gcgttcatcgaacaggtgcgtgcgctcaccatcgaagccgattcgttggcgcacaccgca
ccgatcgaccaggccgtgacgctcaccacgccggcgggtgcggccggaaggcattggaac
cttgtgttcctgccggccttgcaacagggccaatggccgaatctggctccccgcaacacc
ttgttcggcggagagagcctggcggatgtgatgctgcatggcgaactgcgcgacgacatc
gtcacttcggcgggccgccaggatgcgcagttggccgcggtgctcgcctccgagcagaag
agctttcttgtggcgttgacccgcgccgacgaacgcgcggtgctgagcgccgtattgaat
gacgacaatgtgccgtccgattttctgtacggctatctgccggaacgctttgaccgcgaa
cgcgacgccgatccggaacagcgcgattatgcgttggtcggcggtaccggcgagttcaat
gggctcgatgccgatccgcgtggcttggtcgcggctgcgcgcagcgtgctggcggacgaa
ccggccggctcgtccaaggcgaaggatgcggccgctgcgttggcgctgctggcttcgcgt
ggcattgcggccgccgatccagcatattggccgttcgcgaagcagtcggagactgatgat
tcggaatcccgggattcccatcgttccgatgtggtgacgttgtcgccatccgcggtggac
cgcctgtgggcctgcccggtgtgctggatgctcgagaaccgcttcgcgggcccgcgcatg
ggtagcgtggccacgaatttcggctcgctcatccacaaggtggcgcagaaggccaccgaa
gcgggacttgatctgccgcaaaaccacactgcattgaacgacgaggagaacatcgagaat
atcacgcagtggatgatggccgaatacgaacggttgcgtggcgatctgaacgccataccc
gaccccaaggaacgttacgaggcactcggtaaggacgagcgggccgtcgacgcgctacgt
aacatcgccacgtatttcgtcaactcgaaccgtagcggataccccgccaaaaatgccgat
aagttcgaagtcggcaagcttacggaggcggagccggaactgcagttcgccgcacgcttc
ggattcgatgacgttctcgaagcgtacaacgcgatcgagggcgtcgatccgatcgggcgc
ggagagctcatatctctgatggggctgcttgtcggaggatggccggaaaccggcatgagc
gaatggcttacgatacgtctgtcggggcggatcgaccggctggaacgacgcgtgctgagc
ggcggcggcgaacaggtgcgcctaatcgactacaagaccggtaaacagctcagcggccaa
gacatgttcagcgatttgcaacttgcatgctaccaattgggattggcgtttccggaagaa
ggaccgcgcggcgcacaggccattgcactcatgccgaatatcgggcagagcgccctgttc
cacgtcatgtgttccaccgcgccggccccacgcggcacgcagggcgaggaggcatatcac
cagcaggcgctgttcgccaacggaagcctgaatgcgggcaaatatgtgcccaggttctgc
ctccccacgttcgacaaactgttcgtcgacgatctcgacggtgctgaacgccccgaagcg
gtcagcgacgagcattggcggcagttcctggaactgcgctccacaatggcggtgtggtcg
ttgaccatgatcgctcgcgtcttctatgcggcggccgcctgtcgagccataagaatcacc
gcacggccgacatcgaaacacgtgaagtcatgcagaaacaaatcagtctgcccggcctgt
gccggcgaacagaacaccgtcttcgaaaggagagtggcatga

DBGET integrated database retrieval system