KEGG   Bifidobacterium dentium Bd1: BDP_1782Help
Entry
BDP_1782          CDS       T01143                                 

Gene name
rpoB
Definition
(GenBank) DNA-directed RNA polymerase subunit beta RpoB
  KO
K03043  DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00230  Purine metabolism
bde00240  Pyrimidine metabolism
bde01100  Metabolic pathways
bde03020  RNA polymerase
Module
bde_M00183  RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:bde00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BDP_1782 (rpoB)
   00240 Pyrimidine metabolism
    BDP_1782 (rpoB)
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    BDP_1782 (rpoB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bde03021]
    BDP_1782 (rpoB)
   03400 DNA repair and recombination proteins [BR:bde03400]
    BDP_1782 (rpoB)
Enzymes [BR:bde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     BDP_1782 (rpoB)
Transcription machinery [BR:bde03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     BDP_1782 (rpoB)
DNA repair and recombination proteins [BR:bde03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      BDP_1782 (rpoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_2 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpb2_45 RNA_pol_Rpb2_1
Motif
Other DBs
NCBI-ProteinID: ADB10369
UniProt: D2Q604
Position
complement(2033460..2037020)
Genome map
AA seq 1186 aa AA seqDB search
MAEATTNTTTIIARADQHDIDLHKASDRVNFGSIREPIDVPYLLGVQTDSFDWLIGSERW
KQRVEEDLENGTNTVPHTSGLDEVFQEISPIENFAQTMSLTFSDPYFEEPRHTVQECKEK
DYTYSAPLYVNAEFENGDTGEIKSQTVFMGDFPLQTPHGTFIIGGTERVIVSQLVRSPGV
YFDRSQDRTSDKEIFGAKIIPSRGAWLEFEIDKRDVLGVRVDRKRKQSAIVFLMAIGMTK
QEIADAFKDYPLVMDALAKETVDTQEAALTDLYRKIRPADTATPEAGRNLLDSFYFNTKR
YDLARVGRYKINRKLGLEKDVNDRSLSREDIIATIKYLVTLHAGEAKFPGKRDGQDVDLR
VDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRERMTTQDPEAITPQSLINIRPVN
ATIKEFFGTSQLSQFMDQNNPLAGVTNKRRLSALGPGGLSRDRASMEVRDVHPSHFGRMC
PIESPEGPNIGLIGSLATFGRINPFGFIETPYRKVVNGHVTDEVEYMTADRDAEHVIAQA
NQELDENGNFVKSQALARVGEEEAVDVPVSSVDYMDVSPRQMVSVGASLIPFLEHDEGHR
ALMGTNMQRQAVPLIQSERPLVGTGAEWRAAVDSGDVILAEKPGVVTYVSADIIRTMNDD
GTTSSYKLAKFQRSNQTTCYNQVPLIHDGERVEAGTVLADGPATQKGEMALGKNLLIAFM
PWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEIDARETKLGAEEITRDLPNVGEDAVANL
DERGIIRIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLRVPHGET
GTVIAVKEITREDAEEAGDELPNGVNQMIRVYIAQHRKITQGDKLSGRHGNKGVISRILP
EEDMPFLADGTPVDIMLNPLGVPSRMNLGQVLELHLGWIAHAGWDISLDPDAEAAWKKFV
PQGAEKGAPGTPVATPVFDGVRQDTLKGLLSCTLPDRDGNKLVGPDGKATLFDGRTGEPF
PKPISVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAY
GAAYTLHEMMTTKSDDVDGRVRVYGAIVKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLN
AEGVAIDMKDEDDDPSSASDDLGFNIGARPDASAKEEQVVEAPEFQ
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
ttggctgaggctacgacgaacaccaccaccatcatcgcacgcgccgaccagcatgacatt
gatctgcataaggcgtcggaccgtgtgaacttcggctccatccgcgagcccattgatgta
ccctacctgctgggtgtacagaccgacagctttgattggctcatcggcagcgaacgctgg
aagcagcgcgtcgaggaggatctggaaaacggcaccaacaccgtaccgcatacctccggt
ctcgacgaggtcttccaggagatctccccgatcgagaacttcgcgcagaccatgagcctg
accttctccgatccgtatttcgaggagccgcgtcacaccgtgcaggaatgcaaggagaag
gactacacctactccgcaccgctgtacgtgaacgccgaattcgaaaacggcgacaccggc
gaaatcaagtcccagaccgtgttcatgggtgatttcccgctacagaccccgcacggcacc
ttcatcatcggcggtaccgagcgagtgatcgtatcccagctcgtgcgttcccccggcgtg
tacttcgaccgcagccaggaccgtacctccgacaaggagatcttcggcgcgaagatcatc
ccgagccgtggcgcatggctcgagttcgagatcgacaagcgcgatgtgctcggcgtgcgt
gtggaccgcaagcgtaagcagtccgccatcgtgttcctcatggccatcggcatgaccaag
caggagatcgcggacgcgttcaaggattacccgctggtcatggacgccctcgccaaggag
accgtggacacccaggaagcggccctcaccgatctgtaccgcaagatccgcccggccgac
accgccactccggaagccggccgcaatctgctggactccttctacttcaacaccaagcgc
tacgatctggcccgcgtcggccgctacaagatcaaccgcaagctcggtcttgagaaggac
gtcaacgaccgcagcctgtcccgcgaagacatcatcgccaccatcaagtacctggtcacc
ctgcatgcgggcgaggccaagttcccgggcaagcgtgacggtcaggacgtggatctgcgt
gtggatgtcgatgatatcgaccacttcggcaaccgtcgtatccgtcaggtcggagagctg
atccagaaccagctgcgtaccggtctgagccgtatggagcgcgtggtgcgcgaacgcatg
accacgcaggatccggaggccatcaccccgcagtccctgatcaacatccgcccggtgaac
gccaccatcaaggaattcttcggcacctcccagctgtcgcagttcatggatcagaacaac
ccgctggccggcgtgaccaacaagcgccgtctgtccgcactgggccccggcggtctgtcc
cgtgaccgtgcctccatggaagtgcgagacgtgcacccgtcccacttcggccgcatgtgc
ccgatcgaatcccctgaaggcccgaacatcggtcttatcggctccctggcaaccttcggc
cgcatcaacccattcggcttcatcgagaccccgtaccgcaaggtcgtcaacggtcatgtg
accgacgaggtcgaatacatgaccgcggatcgcgatgccgagcacgtgatcgcccaggcc
aaccaggagctcgacgagaacggcaacttcgtcaagagccaggcccttgcccgagtcggc
gaggaagaggcagtcgatgtgccggtcagctccgtcgactacatggatgtgtccccgcgc
cagatggtgtccgtcggtgcctccctgattccgttcctggagcacgatgagggccaccga
gcgctgatgggtaccaacatgcagcgtcaggccgtgccgctgatccagtccgagcgtccg
ctcgtgggcaccggcgccgaatggcgtgccgcagtggattccggcgacgtgatcctggcc
gagaagcccggcgtcgtgacctacgtttccgccgacatcatccgcaccatgaacgacgac
ggcaccaccagctcctacaagctggccaagttccagcgttccaaccagaccacctgctac
aaccaggtgccgctgatccacgacggcgaacgcgtggaagccggtaccgtgctggccgat
ggcccggcgacccagaagggcgaaatggccctgggcaagaacctgctcatcgccttcatg
ccgtggaacggctacaactacgaggacgcagtgatcatctcccagcgtctcgtgcaggat
gacaccctgagctccatccacatcgaggaatacgagattgacgcccgtgaaaccaagctg
ggtgccgaagagatcacccgcgacctgccgaacgtcggcgaggacgcggtggccaacctt
gacgagcgcggcatcatccgcatcggcgccgaggtcgaggccggcgacatcctggtcggc
aaggtcactccgaagggcgagaccgaactgaccccggaagagcgtctgctccgcgccatc
ttcggcgagaagagccgcgaagtgcgtgacacctcgctgcgcgtgcctcatggcgagacc
ggtaccgtgatcgccgtcaaggagatcacccgcgaggacgccgaggaggccggcgacgag
ctgccgaacggcgtgaaccagatgattcgcgtctacatcgcacagcaccgcaagatcacc
cagggcgacaagctctccggccgccacggcaacaagggcgtcatctcccgcatcctgccg
gaagaggatatgccgttcctggccgacggtaccccggtcgacatcatgctcaacccgctg
ggcgtaccttctcgaatgaaccttggccaggtgctcgagctgcacctcggctggatcgcc
cacgccggctgggacatctcccttgacccggatgccgaagccgcttggaagaagttcgtg
ccgcagggcgccgaaaagggcgctccgggcactccggtggcgactccggtgttcgacggc
gtgcgtcaggacaccttgaagggcctgctttcctgcacccttccggaccgtgacggcaac
aagctggtcggacccgacggcaaggcgaccctgttcgacggacgtaccggcgaaccgttc
ccgaagccgatttccgtgggctacatgtacatgctgaagctgcaccatctggtcgacgac
aagatccacgcccgttccaccggcccgtactccatgatcacgcagcagccgctgggtggt
aaggcgcagttcggtggccagcgcttcggcgagatggaagtgtgggccctcgaggcctac
ggtgccgcctacacgctgcacgagatgatgaccaccaagtccgatgacgtcgacggccgc
gtgcgcgtgtacggcgccatcgtgaagggcgacaacctgccgccggcaggcatcccggaa
tccttcaaggtactgctcaaggaaatgcagtccctgtcgctgaacgtcgaggtgctcaac
gccgaaggcgtggccatcgacatgaaggacgaggacgacgacccgtcttccgcctccgac
gacctgggcttcaacatcggtgctcgccctgatgcatccgccaaggaagaacaggtagtg
gaagcccctgaattccagtga

DBGET integrated database retrieval system